PDB entry 1aii

View 1aii on RCSB PDB site
Description: annexin III
Class: calcium/phospholipid binding protein
Keywords: calcium/phospholipid binding protein, annexin, phospholipase a2 inhibitor
Deposited on 1996-11-28, released 1997-03-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.196
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: annexin III
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1aiia_
  • Heterogens: CA, SO4, ETA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1aiiA (A:)
    masiwvghrgtvrdypdfspsvdaeaiqkairgigtdekmlisiltersnaqrqlivkey
    qaaygkelkddlkgdlsghfehlmvalvtppavfdakqlkksmkgagtnedalieilttr
    tsrqmkdisqayytvykkslgddissetsgdfrkalltladgrrdeslkvdehlakqdaq
    ilykagenrwgtdedkfteilclrsfpqlkltfdeyrnisqkdivdsikgelsghfedll
    laivncvrntpaflaerlhralkgigtdeftlnrimvsrseidlldirtefkkhygysly
    saiksdtsgdyeitllkicggdd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aiiA (A:)
    asiwvghrgtvrdypdfspsvdaeaiqkairgigtdekmlisiltersnaqrqlivkeyq
    aaygkelkddlkgdlsghfehlmvalvtppavfdakqlkksmkgagtnedalieilttrt
    srqmkdisqayytvykkslgddissetsgdfrkalltladgrrdeslkvdehlakqdaqi
    lykagenrwgtdedkfteilclrsfpqlkltfdeyrnisqkdivdsikgelsghfedlll
    aivncvrntpaflaerlhralkgigtdeftlnrimvsrseidlldirtefkkhygyslys
    aiksdtsgdyeitllkicggdd