PDB entry 1aih

View 1aih on RCSB PDB site
Description: catalytic domain of bacteriophage hp1 integrase
Deposited on 1997-04-17, released 1997-08-20
The last revision prior to the SCOP 1.55 freeze date was dated 1997-08-20, with a file datestamp of 1997-08-20.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.209
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1aiha_
  • Chain 'B':
    Domains in SCOP 1.55: d1aihb_
  • Chain 'C':
    Domains in SCOP 1.55: d1aihc_
  • Chain 'D':
    Domains in SCOP 1.55: d1aihd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aihA (A:)
    etelaflyerdiyrllaecdnsrnpdlglivriclatgarwseaetltqsqvmpykitft
    ntkskknrtvpisdelfdmlpkkrgrlfndayesfenavlraeielpkgqlthvlrhtfa
    shfmmnggnilvlkeilghstiemtmryahfapshlesavkfnplsnpaq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aihB (B:)
    elaflyerdiyrllaecdnsrnpdlglivriclatgarwseaetltqsqvmpykitftnt
    kskknrtvpisdelfdmlpkkrgrlfndayesfenavlraeielpkgqlthvlrhtfash
    fmmnggnilvlkeilghstiemtmryahfapshlesavkfnplsnpaq
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aihC (C:)
    elaflyerdiyrllaecdnsrnpdlglivriclatgarwseaetltqsqvmpykitftnt
    kskknrtvpisdelfdmlpkkrgrlfndayesfenavlraeielpkgqlthvlrhtfash
    fmmnggnilvlkeilghstiemtmryahfapshlesavkfnplsnpaq
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aihD (D:)
    etelaflyerdiyrllaecdnsrnpdlglivriclatgarwseaetltqsqvmpykitft
    ntkskknrtvpisdelfdmlpkkrgrlfndayesfenavlraeielpkgqlthvlrhtfa
    shfmmnggnilvlkeilghstiemtmryahfapshlesavkfnplsnpaq