PDB entry 1aih

View 1aih on RCSB PDB site
Description: catalytic domain of bacteriophage hp1 integrase
Class: DNA integration
Keywords: DNA integration, recombination
Deposited on 1997-04-17, released 1997-08-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.209
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hp1 integrase
    Species: Haemophilus phage HP1 [TaxId:10690]
    Gene: GENBANK U24159
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21442 (0-169)
      • conflict (73)
    Domains in SCOPe 2.07: d1aiha_
  • Chain 'B':
    Compound: hp1 integrase
    Species: Haemophilus phage HP1 [TaxId:10690]
    Gene: GENBANK U24159
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21442 (Start-169)
      • conflict (73)
    Domains in SCOPe 2.07: d1aihb_
  • Chain 'C':
    Compound: hp1 integrase
    Species: Haemophilus phage HP1 [TaxId:10690]
    Gene: GENBANK U24159
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21442 (Start-169)
      • conflict (73)
    Domains in SCOPe 2.07: d1aihc_
  • Chain 'D':
    Compound: hp1 integrase
    Species: Haemophilus phage HP1 [TaxId:10690]
    Gene: GENBANK U24159
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21442 (0-169)
      • conflict (73)
    Domains in SCOPe 2.07: d1aihd_
  • Heterogens: SO4, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aihA (A:)
    etelaflyerdiyrllaecdnsrnpdlglivriclatgarwseaetltqsqvmpykitft
    ntkskknrtvpisdelfdmlpkkrgrlfndayesfenavlraeielpkgqlthvlrhtfa
    shfmmnggnilvlkeilghstiemtmryahfapshlesavkfnplsnpaq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1aihB (B:)
    etelaflyerdiyrllaecdnsrnpdlglivriclatgarwseaetltqsqvmpykitft
    ntkskknrtvpisdelfdmlpkkrgrlfndayesfenavlraeielpkgqlthvlrhtfa
    shfmmnggnilvlkeilghstiemtmryahfapshlesavkfnplsnpaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aihB (B:)
    elaflyerdiyrllaecdnsrnpdlglivriclatgarwseaetltqsqvmpykitftnt
    kskknrtvpisdelfdmlpkkrgrlfndayesfenavlraeielpkgqlthvlrhtfash
    fmmnggnilvlkeilghstiemtmryahfapshlesavkfnplsnpaq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1aihC (C:)
    etelaflyerdiyrllaecdnsrnpdlglivriclatgarwseaetltqsqvmpykitft
    ntkskknrtvpisdelfdmlpkkrgrlfndayesfenavlraeielpkgqlthvlrhtfa
    shfmmnggnilvlkeilghstiemtmryahfapshlesavkfnplsnpaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aihC (C:)
    elaflyerdiyrllaecdnsrnpdlglivriclatgarwseaetltqsqvmpykitftnt
    kskknrtvpisdelfdmlpkkrgrlfndayesfenavlraeielpkgqlthvlrhtfash
    fmmnggnilvlkeilghstiemtmryahfapshlesavkfnplsnpaq
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aihD (D:)
    etelaflyerdiyrllaecdnsrnpdlglivriclatgarwseaetltqsqvmpykitft
    ntkskknrtvpisdelfdmlpkkrgrlfndayesfenavlraeielpkgqlthvlrhtfa
    shfmmnggnilvlkeilghstiemtmryahfapshlesavkfnplsnpaq