PDB entry 1aif

View 1aif on RCSB PDB site
Description: anti-idiotypic fab 409.5.3 (igg2a) fab from mouse
Class: immunoglobulin
Keywords: immunoglobulin, c region, v region
Deposited on 1994-11-14, released 1997-02-01
The last revision prior to the SCOP 1.73 freeze date was dated 1997-02-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.22
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: anti-idiotypic fab 409.5.3 (igg2a) fab (light chain)
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01837 (1-214)
      • conflict (2)
      • conflict (9)
      • conflict (11)
      • conflict (17)
      • conflict (20)
      • conflict (24-25)
      • insertion (27-28)
      • conflict (30)
      • conflict (32-33)
      • conflict (41)
      • conflict (46)
      • conflict (50)
      • conflict (53)
      • conflict (60)
      • conflict (92)
      • conflict (94)
      • conflict (113)
    Domains in SCOP 1.73: d1aifa1, d1aifa2
  • Chain 'B':
    Compound: anti-idiotypic fab 409.5.3 (igg2a) fab (heavy chain)
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed):
    • GB AAB34981 (0-217)
      • conflict (4)
      • conflict (19)
      • conflict (27)
      • conflict (29-30)
      • conflict (34)
      • conflict (42)
      • conflict (47)
      • conflict (52-53)
      • insertion (55)
      • conflict (57-58)
      • conflict (68)
      • conflict (70)
      • conflict (79-80)
      • conflict (86)
      • insertion (98)
      • conflict (99)
      • conflict (101-103)
      • conflict (106-108)
      • conflict (115)
      • conflict (120)
      • insertion (195)
    Domains in SCOP 1.73: d1aifb1, d1aifb2
  • Chain 'H':
    Compound: anti-idiotypic fab 409.5.3 (igg2a) fab (heavy chain)
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed):
    • GB AAB34981 (0-217)
      • conflict (4)
      • conflict (19)
      • conflict (27)
      • conflict (29-30)
      • conflict (34)
      • conflict (42)
      • conflict (47)
      • conflict (52-53)
      • insertion (55)
      • conflict (57-58)
      • conflict (68)
      • conflict (70)
      • conflict (79-80)
      • conflict (86)
      • insertion (98)
      • conflict (99)
      • conflict (101-103)
      • conflict (106-108)
      • conflict (115)
      • conflict (120)
      • insertion (195)
    Domains in SCOP 1.73: d1aifh1, d1aifh2
  • Chain 'L':
    Compound: anti-idiotypic fab 409.5.3 (igg2a) fab (light chain)
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01837 (1-214)
      • conflict (2)
      • conflict (9)
      • conflict (11)
      • conflict (17)
      • conflict (20)
      • conflict (24-25)
      • insertion (27-28)
      • conflict (30)
      • conflict (32-33)
      • conflict (41)
      • conflict (46)
      • conflict (50)
      • conflict (53)
      • conflict (60)
      • conflict (92)
      • conflict (94)
      • conflict (113)
    Domains in SCOP 1.73: d1aifl1, d1aifl2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aifA (A:)
    diqltqspafmaaspgekvtitcsvsssisssnlhwyqqksetspkpwiygtsnlasgvp
    vrfsgsgsgtsysltissmeaedaatyycqqwnsypytfgggtkleikradaaptvsifp
    psseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstl
    tltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aifB (B:)
    evklqesggglvqpggsmklscvasgftfnnywmswvrqspekglewvaeirlnsdnfat
    hyaesvkgkfiisrddsksrlylqmnslraedtgiyycvlrplfyyavdywgqgtsvtvs
    sakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqs
    dlytlsssvtvpstwrpsetvtcnvahpasstkvdkki
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aifH (H:)
    evklqesggglvqpggsmklscvasgftfnnywmswvrqspekglewvaeirlnsdnfat
    hyaesvkgkfiisrddsksrlylqmnslraedtgiyycvlrplfyyavdywgqgtsvtvs
    sakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqs
    dlytlsssvtvpstwrpsetvtcnvahpasstkvdkki
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aifL (L:)
    diqltqspafmaaspgekvtitcsvsssisssnlhwyqqksetspkpwiygtsnlasgvp
    vrfsgsgsgtsysltissmeaedaatyycqqwnsypytfgggtkleikradaaptvsifp
    psseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstl
    tltkdeyerhnsytceathktstspivksfnrnec