PDB entry 1aie

View 1aie on RCSB PDB site
Description: p53 tetramerization domain crystal structure
Class: p53 tetramerization
Keywords: p53 tetramerization, oligomer, DNA, transcription, tumor suppressor
Deposited on 1997-04-17, released 1997-06-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.191
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: p53
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04637 (0-30)
  Domains in SCOPe 2.08: d1aiea_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1aieA (A:)
  eyftlqirgrerfemfrelnealelkdaqag