PDB entry 1aia

View 1aia on RCSB PDB site
Description: structural basis for the catalytic activity of aspartate aminotransferase k258h lacking the pyridoxal-5'-phosphate binding lysine residue
Deposited on 1994-05-10, released 1994-10-15
The last revision prior to the SCOP 1.55 freeze date was dated 1994-10-15, with a file datestamp of 1994-10-15.
Experiment type: -
Resolution: 2.2 Å
R-factor: 0.21
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1aiaa_
  • Chain 'B':
    Domains in SCOP 1.55: d1aiab_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aiaA (A:)
    mfenitaapadpilgladlfraderpgkinlgigvykdetgktpvltsvkkaeqyllene
    ttknylgidgipefgrctqellfgkgsalindkrartaqtpggtgalrvaadflakntsv
    krvwvsnpswpnhksvfnsaglevreyayydaenhtldfdalinslneaqagdvvlfhgc
    chnptgidptleqwqtlaqlsvekgwlplfdfayqgfargleedaeglrafaamhkeliv
    assyshnfglynervgactlvaadsetvdrafsqmkaairanysnppahgasvvatilsn
    dalraiweqeltdmrqriqrmrqlfvntlqekganrdfsfiikqngmfsfsgltkeqvlr
    lreefgvyavasgrvnvagmtpdnmaplceaivavl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aiaB (B:)
    mfenitaapadpilgladlfraderpgkinlgigvykdetgktpvltsvkkaeqyllene
    ttknylgidgipefgrctqellfgkgsalindkrartaqtpggtgalrvaadflakntsv
    krvwvsnpswpnhksvfnsaglevreyayydaenhtldfdalinslneaqagdvvlfhgc
    chnptgidptleqwqtlaqlsvekgwlplfdfayqgfargleedaeglrafaamhkeliv
    assyshnfglynervgactlvaadsetvdrafsqmkaairanysnppahgasvvatilsn
    dalraiweqeltdmrqriqrmrqlfvntlqekganrdfsfiikqngmfsfsgltkeqvlr
    lreefgvyavasgrvnvagmtpdnmaplceaivavl