PDB entry 1ai2

View 1ai2 on RCSB PDB site
Description: isocitrate dehydrogenase complexed with isocitrate, nadp+, and calcium (flash-cooled)
Class: oxidoreductase
Keywords: oxidoreductase (nad(a)-choh(d)), nadp, phosphorylation, glyoxylate bypass, oxidoreductase
Deposited on 1997-04-30, released 1997-10-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.191
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: isocitrate dehydrogenase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ai2a_
  • Heterogens: NAP, ICA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ai2A (A:)
    meskvvvpaqgkkitlqngklnvpenpiipyiegdgigvdvtpamlkvvdaavekaykge
    rkiswmeiytgekstqvygqdvwlpaetldlireyrvaikgplttpvgggirslnvalrq
    eldlyiclrpvryyqgtpspvkhpeltdmvifrensediyagiewkadsadaekvikflr
    eemgvkkirfpehcgigikpcseegtkrlvraaieyaiandrdsvtlvhkgnimkftega
    fkdwgyqlareefggelidggpwlkvknpntgkeivikdviadaflqqillrpaeydvia
    cmnlngdyisdalaaqvggigiapganigdecalfeathgtapkyagqdkvnpgsiilsa
    emmlrhmgwteaadlivkgmegainaktvtydferlmdgakllkcsefgdaiienm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ai2A (A:)
    skvvvpaqgkkitlqngklnvpenpiipyiegdgigvdvtpamlkvvdaavekaykgerk
    iswmeiytgekstqvygqdvwlpaetldlireyrvaikgplttpvgggirslnvalrqel
    dlyiclrpvryyqgtpspvkhpeltdmvifrensediyagiewkadsadaekvikflree
    mgvkkirfpehcgigikpcseegtkrlvraaieyaiandrdsvtlvhkgnimkftegafk
    dwgyqlareefggelidggpwlkvknpntgkeivikdviadaflqqillrpaeydviacm
    nlngdyisdalaaqvggigiapganigdecalfeathgtapkyagqdkvnpgsiilsaem
    mlrhmgwteaadlivkgmegainaktvtydferlmdgakllkcsefgdaiienm