PDB entry 1ai1

View 1ai1 on RCSB PDB site
Description: hiv-1 v3 loop mimic
Class: complex (antibody/peptide)
Keywords: complex (antibody/peptide), antibody, constrained hiv-1 v3 loop peptide, immunoglobulin
Deposited on 1996-11-06, released 1997-05-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.22
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: igg1-kappa 59.1 fab (heavy chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ai1h1, d1ai1h2
  • Chain 'L':
    Compound: igg1-kappa 59.1 fab (light chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • EMBL CAB75889 (1-214)
      • conflict (3)
      • conflict (11)
      • conflict (25-26)
      • conflict (33)
      • conflict (49)
      • conflict (53)
      • conflict (58)
      • conflict (99)
      • conflict (103)
      • conflict (109-110)
    Domains in SCOPe 2.08: d1ai1l1, d1ai1l2
  • Chain 'P':
    Compound: aib142
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05877
      • conflict (13)

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ai1H (H:)
    qvklqesgpavikpsqslsltcivsgfsitrtnycwhwirqapgkglewmgricyegsiy
    yspsiksrstisrdtslnkffiqlisvtnedtamyycsrenhmyetyfdvwgqgttvtvs
    sakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqs
    dlytlsssvtvpssprpsetvtcnvahpasstkvdkkivpr
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ai1L (L:)
    divmtqspaslvvslgqratiscrasesvdsygksfmhwyqqkpgqppkvliyiasnles
    gvparfsgsgsrtdftltidpveaddaatyycqqnnedpptfgagtklemrradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnr
    

  • Chain 'P':
    No sequence available.