PDB entry 1ai0

View 1ai0 on RCSB PDB site
Description: r6 human insulin hexamer (non-symmetric), nmr, 10 structures
Class: hormone
Keywords: hormone, glucose metabolism
Deposited on 1997-04-30, released 1997-11-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-06-09, with a file datestamp of 2009-06-05.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: r6 insulin hexamer
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ai0.1
  • Chain 'B':
    Compound: r6 insulin hexamer
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ai0.1
  • Chain 'C':
    Compound: r6 insulin hexamer
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ai0.2
  • Chain 'D':
    Compound: r6 insulin hexamer
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ai0.2
  • Chain 'E':
    Compound: r6 insulin hexamer
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ai0.3
  • Chain 'F':
    Compound: r6 insulin hexamer
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ai0.3
  • Chain 'G':
    Compound: r6 insulin hexamer
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ai0.4
  • Chain 'H':
    Compound: r6 insulin hexamer
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ai0.4
  • Chain 'I':
    Compound: r6 insulin hexamer
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ai0.5
  • Chain 'J':
    Compound: r6 insulin hexamer
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ai0.5
  • Chain 'K':
    Compound: r6 insulin hexamer
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ai0.6
  • Chain 'L':
    Compound: r6 insulin hexamer
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ai0.6
  • Heterogens: ZN, IPH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ai0A (A:)
    giveqcctsicslyqlenycn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ai0B (B:)
    fvnqhlcgshlvealylvcgergffytpkt
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ai0C (C:)
    giveqcctsicslyqlenycn
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ai0D (D:)
    fvnqhlcgshlvealylvcgergffytpkt
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ai0E (E:)
    giveqcctsicslyqlenycn
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ai0F (F:)
    fvnqhlcgshlvealylvcgergffytpkt
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ai0G (G:)
    giveqcctsicslyqlenycn
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ai0H (H:)
    fvnqhlcgshlvealylvcgergffytpkt
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ai0I (I:)
    giveqcctsicslyqlenycn
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ai0J (J:)
    fvnqhlcgshlvealylvcgergffytpkt
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ai0K (K:)
    giveqcctsicslyqlenycn
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ai0L (L:)
    fvnqhlcgshlvealylvcgergffytpkt