PDB entry 1ahw

View 1ahw on RCSB PDB site
Description: a complex of extracellular domain of tissue factor with an inhibitory fab (5g9)
Deposited on 1997-04-10, released 1998-02-25
The last revision prior to the SCOP 1.57 freeze date was dated 1998-08-19, with a file datestamp of 1998-08-19.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.217
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ahwA (A:)
    dikmtqspssmyaslgervtitckasqdirkylnwyqqkpwkspktliyyatsladgvps
    rfsgsgsgqdysltisslesddtatyyclqhgespytfgggtkleinradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ahwB (B:)
    eiqlqqsgaelvrpgalvklsckasgfnikdyymhwvkqrpeqglewiglidpengntiy
    dpkfqgkasitadtssntaylqlssltsedtavyycardnsyyfdywgqgttltvssakt
    tppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlyt
    lsssvtvpsstwpsetvtcnvahpasstkvdkki
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ahwC (C:)
    tntvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltdei
    vkdvkqtylarvfsypagnvestgsageplyenspeftpyletnlgqptiqsfeqvgtkv
    nvtvedertlvrrnntflslrdvfgkdliytlyywkssssgkktaktntneflidvdkge
    nycfsvqavipsrtvnrkstdspvecmg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ahwC (C:)
    tntvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltdei
    vkdvkqtylarvfsypagneplyenspeftpyletnlgqptiqsfeqvgtkvnvtveder
    tlvrrnntflslrdvfgkdliytlyywkssssgkktaktntneflidvdkgenycfsvqa
    vipsrtvnrkstdspvecmg
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ahwD (D:)
    dikmtqspssmyaslgervtitckasqdirkylnwyqqkpwkspktliyyatsladgvps
    rfsgsgsgqdysltisslesddtatyyclqhgespytfgggtkleinradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ahwE (E:)
    eiqlqqsgaelvrpgalvklsckasgfnikdyymhwvkqrpeqglewiglidpengntiy
    dpkfqgkasitadtssntaylqlssltsedtavyycardnsyyfdywgqgttltvssakt
    tppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlyt
    lsssvtvpsstwpsetvtcnvahpasstkvdkki
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1ahwF (F:)
    tntvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltdei
    vkdvkqtylarvfsypagnvestgsageplyenspeftpyletnlgqptiqsfeqvgtkv
    nvtvedertlvrrnntflslrdvfgkdliytlyywkssssgkktaktntneflidvdkge
    nycfsvqavipsrtvnrkstdspvecmg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ahwF (F:)
    tntvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltdei
    vkdvkqtylarvfsypagneplyenspeftpyletnlgqptiqsfeqvgtkvnvtveder
    tlvrrnntflslrdvfgkdliytlyywkssssgkktaktntneflidvdkgenycfsvqa
    vipsrtvnrkstdspvecmg