PDB entry 1ahw

View 1ahw on RCSB PDB site
Description: a complex of extracellular domain of tissue factor with an inhibitory fab (5g9)
Class: complex (immunoglobulin/tissue factor)
Keywords: blood coagulation, tissue factor, fab, complex, antibody, complex (immunoglobulin/tissue factor)
Deposited on 1997-04-10, released 1998-02-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.217
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: immunoglobulin fab 5g9 (light chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01837 (0-213)
      • conflict (29-30)
      • conflict (33)
      • conflict (35)
      • conflict (40)
      • conflict (49)
      • conflict (51-52)
      • conflict (54)
      • conflict (79-80)
      • conflict (82-84)
      • conflict (90-91)
      • conflict (93)
      • conflict (106)
    Domains in SCOPe 2.07: d1ahwa1, d1ahwa2
  • Chain 'B':
    Compound: immunoglobulin fab 5g9 (heavy chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PIR S49220 (2-213)
      • insertion (0-1)
      • conflict (4-5)
      • conflict (12-13)
      • conflict (16)
      • conflict (22)
      • conflict (31)
      • conflict (49)
      • conflict (53)
      • conflict (56-58)
      • conflict (66)
      • conflict (68)
      • conflict (75)
      • conflict (96)
      • conflict (98-99)
      • conflict (101-104)
    Domains in SCOPe 2.07: d1ahwb1, d1ahwb2
  • Chain 'C':
    Compound: tissue factor
    Species: Homo sapiens [TaxId:9606]
    Gene: HUMAN TISSUE FACTOR EXTRACELLU
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ahwc1, d1ahwc2
  • Chain 'D':
    Compound: immunoglobulin fab 5g9 (light chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01837 (0-213)
      • conflict (29-30)
      • conflict (33)
      • conflict (35)
      • conflict (40)
      • conflict (49)
      • conflict (51-52)
      • conflict (54)
      • conflict (79-80)
      • conflict (82-84)
      • conflict (90-91)
      • conflict (93)
      • conflict (106)
    Domains in SCOPe 2.07: d1ahwd1, d1ahwd2
  • Chain 'E':
    Compound: immunoglobulin fab 5g9 (heavy chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PIR S49220 (2-213)
      • insertion (0-1)
      • conflict (4-5)
      • conflict (12-13)
      • conflict (16)
      • conflict (22)
      • conflict (31)
      • conflict (49)
      • conflict (53)
      • conflict (56-58)
      • conflict (66)
      • conflict (68)
      • conflict (75)
      • conflict (96)
      • conflict (98-99)
      • conflict (101-104)
    Domains in SCOPe 2.07: d1ahwe1, d1ahwe2
  • Chain 'F':
    Compound: tissue factor
    Species: Homo sapiens [TaxId:9606]
    Gene: HUMAN TISSUE FACTOR EXTRACELLU
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ahwf1, d1ahwf2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ahwA (A:)
    dikmtqspssmyaslgervtitckasqdirkylnwyqqkpwkspktliyyatsladgvps
    rfsgsgsgqdysltisslesddtatyyclqhgespytfgggtkleinradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ahwB (B:)
    eiqlqqsgaelvrpgalvklsckasgfnikdyymhwvkqrpeqglewiglidpengntiy
    dpkfqgkasitadtssntaylqlssltsedtavyycardnsyyfdywgqgttltvssakt
    tppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlyt
    lsssvtvpsstwpsetvtcnvahpasstkvdkki
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ahwC (C:)
    sgttntvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdlt
    deivkdvkqtylarvfsypagnvestgsageplyenspeftpyletnlgqptiqsfeqvg
    tkvnvtvedertlvrrnntflslrdvfgkdliytlyywkssssgkktaktntneflidvd
    kgenycfsvqavipsrtvnrkstdspvecmgqekgefre
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ahwC (C:)
    tntvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltdei
    vkdvkqtylarvfsypagneplyenspeftpyletnlgqptiqsfeqvgtkvnvtveder
    tlvrrnntflslrdvfgkdliytlyywkssssgkktaktntneflidvdkgenycfsvqa
    vipsrtvnrkstdspvecmg
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ahwD (D:)
    dikmtqspssmyaslgervtitckasqdirkylnwyqqkpwkspktliyyatsladgvps
    rfsgsgsgqdysltisslesddtatyyclqhgespytfgggtkleinradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ahwE (E:)
    eiqlqqsgaelvrpgalvklsckasgfnikdyymhwvkqrpeqglewiglidpengntiy
    dpkfqgkasitadtssntaylqlssltsedtavyycardnsyyfdywgqgttltvssakt
    tppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlyt
    lsssvtvpsstwpsetvtcnvahpasstkvdkki
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1ahwF (F:)
    sgttntvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdlt
    deivkdvkqtylarvfsypagnvestgsageplyenspeftpyletnlgqptiqsfeqvg
    tkvnvtvedertlvrrnntflslrdvfgkdliytlyywkssssgkktaktntneflidvd
    kgenycfsvqavipsrtvnrkstdspvecmgqekgefre
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ahwF (F:)
    tntvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltdei
    vkdvkqtylarvfsypagneplyenspeftpyletnlgqptiqsfeqvgtkvnvtveder
    tlvrrnntflslrdvfgkdliytlyywkssssgkktaktntneflidvdkgenycfsvqa
    vipsrtvnrkstdspvecmg