PDB entry 1ahv

View 1ahv on RCSB PDB site
Description: structure of the octameric flavoenzyme vanillyl-alcohol oxidase in complex with 2-nitro-p-cresol
Class: flavoenzyme
Keywords: flavoenzyme, oxidase, catalysis
Deposited on 1997-04-10, released 1997-10-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.206
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: vanillyl-alcohol oxidase
    Species: Penicillium simplicissimum [TaxId:69488]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ahva1, d1ahva2
  • Chain 'B':
    Compound: vanillyl-alcohol oxidase
    Species: Penicillium simplicissimum [TaxId:69488]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ahvb1, d1ahvb2
  • Heterogens: FAD, NCR

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ahvA (A:)
    msktqefrpltlppklslsdfnefiqdiirivgsenvevisskdqivdgsymkpththdp
    hhvmdqdyflasaivaprnvadvqsivglankfsfplwpisigrnsgyggaaprvsgsvv
    ldmgknmnrvlevnvegaycvvepgvtyhdlhnyleannlrdklwldvpdlgggsvlgna
    vergvgytpygdhwmmhsgmevvlangellrtgmgalpdpkrpetmglkpedqpwskiah
    lfpygfgpyidglfsqsnmgivtkigiwlmpnprgyqsylitlpkdgdlkqavdiirplr
    lgmalqnvptirhilldaavlgdkrsyssrteplsdeeldkiakqlnlgrwnfygalygp
    epirrvlwetikdafsaipgvkfyfpedtpensvlrvrdktmqgiptydelkwidwlpng
    ahlffspiakvsgedammqyavtkkrcqeagldfigtftvgmremhhivcivfnkkdliq
    krkvqwlmrtliddcaangwgeyrthlafmdqimetynwnnssflrfnevlknavdpngi
    iapgksgvwpsqyshvtwkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ahvA (A:)
    efrpltlppklslsdfnefiqdiirivgsenvevisskdqivdgsymkpththdphhvmd
    qdyflasaivaprnvadvqsivglankfsfplwpisigrnsgyggaaprvsgsvvldmgk
    nmnrvlevnvegaycvvepgvtyhdlhnyleannlrdklwldvpdlgggsvlgnavergv
    gytpygdhwmmhsgmevvlangellrtgmgalpdpkrpetmglkpedqpwskiahlfpyg
    fgpyidglfsqsnmgivtkigiwlmpnprgyqsylitlpkdgdlkqavdiirplrlgmal
    qnvptirhilldaavlgdkrsyssrteplsdeeldkiakqlnlgrwnfygalygpepirr
    vlwetikdafsaipgvkfyfpedtpensvlrvrdktmqgiptydelkwidwlpngahlff
    spiakvsgedammqyavtkkrcqeagldfigtftvgmremhhivcivfnkkdliqkrkvq
    wlmrtliddcaangwgeyrthlafmdqimetynwnnssflrfnevlknavdpngiiapgk
    sgvwpsqyshvtwkl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ahvB (B:)
    msktqefrpltlppklslsdfnefiqdiirivgsenvevisskdqivdgsymkpththdp
    hhvmdqdyflasaivaprnvadvqsivglankfsfplwpisigrnsgyggaaprvsgsvv
    ldmgknmnrvlevnvegaycvvepgvtyhdlhnyleannlrdklwldvpdlgggsvlgna
    vergvgytpygdhwmmhsgmevvlangellrtgmgalpdpkrpetmglkpedqpwskiah
    lfpygfgpyidglfsqsnmgivtkigiwlmpnprgyqsylitlpkdgdlkqavdiirplr
    lgmalqnvptirhilldaavlgdkrsyssrteplsdeeldkiakqlnlgrwnfygalygp
    epirrvlwetikdafsaipgvkfyfpedtpensvlrvrdktmqgiptydelkwidwlpng
    ahlffspiakvsgedammqyavtkkrcqeagldfigtftvgmremhhivcivfnkkdliq
    krkvqwlmrtliddcaangwgeyrthlafmdqimetynwnnssflrfnevlknavdpngi
    iapgksgvwpsqyshvtwkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ahvB (B:)
    efrpltlppklslsdfnefiqdiirivgsenvevisskdqivdgsymkpththdphhvmd
    qdyflasaivaprnvadvqsivglankfsfplwpisigrnsgyggaaprvsgsvvldmgk
    nmnrvlevnvegaycvvepgvtyhdlhnyleannlrdklwldvpdlgggsvlgnavergv
    gytpygdhwmmhsgmevvlangellrtgmgalpdpkrpetmglkpedqpwskiahlfpyg
    fgpyidglfsqsnmgivtkigiwlmpnprgyqsylitlpkdgdlkqavdiirplrlgmal
    qnvptirhilldaavlgdkrsyssrteplsdeeldkiakqlnlgrwnfygalygpepirr
    vlwetikdafsaipgvkfyfpedtpensvlrvrdktmqgiptydelkwidwlpngahlff
    spiakvsgedammqyavtkkrcqeagldfigtftvgmremhhivcivfnkkdliqkrkvq
    wlmrtliddcaangwgeyrthlafmdqimetynwnnssflrfnevlknavdpngiiapgk
    sgvwpsqyshvtwkl