PDB entry 1ahu

View 1ahu on RCSB PDB site
Description: structure of the octameric flavoenzyme vanillyl-alcohol oxidase in complex with p-cresol
Deposited on 1997-04-10, released 1997-10-15
The last revision prior to the SCOP 1.57 freeze date was dated 1997-10-15, with a file datestamp of 1997-10-15.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.222
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ahuA (A:)
    efrpltlppklslsdfnefiqdiirivgsenvevisskdqivdgsymkpththdphhvmd
    qdyflasaivaprnvadvqsivglankfsfplwpisigrnsgyggaaprvsgsvvldmgk
    nmnrvlevnvegaycvvepgvtyhdlhnyleannlrdklwldvpdlgggsvlgnavergv
    gytpygdhwmmhsgmevvlangellrtgmgalpdpkrpetmglkpedqpwskiahlfpyg
    fgpyidglfsqsnmgivtkigiwlmpnprgyqsylitlpkdgdlkqavdiirplrlgmal
    qnvptirhilldaavlgdkrsyssrteplsdeeldkiakqlnlgrwnfygalygpepirr
    vlwetikdafsaipgvkfyfpedtpensvlrvrdktmqgiptydelkwidwlpngahlff
    spiakvsgedammqyavtkkrcqeagldfigtftvgmremhhivcivfnkkdliqkrkvq
    wlmrtliddcaangwgeyrthlafmdqimetynwnnssflrfnevlknavdpngiiapgk
    sgvwpsqyshvtwkl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ahuB (B:)
    efrpltlppklslsdfnefiqdiirivgsenvevisskdqivdgsymkpththdphhvmd
    qdyflasaivaprnvadvqsivglankfsfplwpisigrnsgyggaaprvsgsvvldmgk
    nmnrvlevnvegaycvvepgvtyhdlhnyleannlrdklwldvpdlgggsvlgnavergv
    gytpygdhwmmhsgmevvlangellrtgmgalpdpkrpetmglkpedqpwskiahlfpyg
    fgpyidglfsqsnmgivtkigiwlmpnprgyqsylitlpkdgdlkqavdiirplrlgmal
    qnvptirhilldaavlgdkrsyssrteplsdeeldkiakqlnlgrwnfygalygpepirr
    vlwetikdafsaipgvkfyfpedtpensvlrvrdktmqgiptydelkwidwlpngahlff
    spiakvsgedammqyavtkkrcqeagldfigtftvgmremhhivcivfnkkdliqkrkvq
    wlmrtliddcaangwgeyrthlafmdqimetynwnnssflrfnevlknavdpngiiapgk
    sgvwpsqyshvtwkl