PDB entry 1ahu

View 1ahu on RCSB PDB site
Description: structure of the octameric flavoenzyme vanillyl-alcohol oxidase in complex with p-cresol
Class: flavoenzyme
Keywords: flavoenzyme, oxidase, catalysis
Deposited on 1997-04-10, released 1997-10-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.222
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: vanillyl-alcohol oxidase
    Species: Penicillium simplicissimum [TaxId:69488]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ahua1, d1ahua2
  • Chain 'B':
    Compound: vanillyl-alcohol oxidase
    Species: Penicillium simplicissimum [TaxId:69488]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ahub1, d1ahub2
  • Heterogens: FAA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ahuA (A:)
    msktqefrpltlppklslsdfnefiqdiirivgsenvevisskdqivdgsymkpththdp
    hhvmdqdyflasaivaprnvadvqsivglankfsfplwpisigrnsgyggaaprvsgsvv
    ldmgknmnrvlevnvegaycvvepgvtyhdlhnyleannlrdklwldvpdlgggsvlgna
    vergvgytpygdhwmmhsgmevvlangellrtgmgalpdpkrpetmglkpedqpwskiah
    lfpygfgpyidglfsqsnmgivtkigiwlmpnprgyqsylitlpkdgdlkqavdiirplr
    lgmalqnvptirhilldaavlgdkrsyssrteplsdeeldkiakqlnlgrwnfygalygp
    epirrvlwetikdafsaipgvkfyfpedtpensvlrvrdktmqgiptydelkwidwlpng
    ahlffspiakvsgedammqyavtkkrcqeagldfigtftvgmremhhivcivfnkkdliq
    krkvqwlmrtliddcaangwgeyrthlafmdqimetynwnnssflrfnevlknavdpngi
    iapgksgvwpsqyshvtwkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ahuA (A:)
    efrpltlppklslsdfnefiqdiirivgsenvevisskdqivdgsymkpththdphhvmd
    qdyflasaivaprnvadvqsivglankfsfplwpisigrnsgyggaaprvsgsvvldmgk
    nmnrvlevnvegaycvvepgvtyhdlhnyleannlrdklwldvpdlgggsvlgnavergv
    gytpygdhwmmhsgmevvlangellrtgmgalpdpkrpetmglkpedqpwskiahlfpyg
    fgpyidglfsqsnmgivtkigiwlmpnprgyqsylitlpkdgdlkqavdiirplrlgmal
    qnvptirhilldaavlgdkrsyssrteplsdeeldkiakqlnlgrwnfygalygpepirr
    vlwetikdafsaipgvkfyfpedtpensvlrvrdktmqgiptydelkwidwlpngahlff
    spiakvsgedammqyavtkkrcqeagldfigtftvgmremhhivcivfnkkdliqkrkvq
    wlmrtliddcaangwgeyrthlafmdqimetynwnnssflrfnevlknavdpngiiapgk
    sgvwpsqyshvtwkl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ahuB (B:)
    msktqefrpltlppklslsdfnefiqdiirivgsenvevisskdqivdgsymkpththdp
    hhvmdqdyflasaivaprnvadvqsivglankfsfplwpisigrnsgyggaaprvsgsvv
    ldmgknmnrvlevnvegaycvvepgvtyhdlhnyleannlrdklwldvpdlgggsvlgna
    vergvgytpygdhwmmhsgmevvlangellrtgmgalpdpkrpetmglkpedqpwskiah
    lfpygfgpyidglfsqsnmgivtkigiwlmpnprgyqsylitlpkdgdlkqavdiirplr
    lgmalqnvptirhilldaavlgdkrsyssrteplsdeeldkiakqlnlgrwnfygalygp
    epirrvlwetikdafsaipgvkfyfpedtpensvlrvrdktmqgiptydelkwidwlpng
    ahlffspiakvsgedammqyavtkkrcqeagldfigtftvgmremhhivcivfnkkdliq
    krkvqwlmrtliddcaangwgeyrthlafmdqimetynwnnssflrfnevlknavdpngi
    iapgksgvwpsqyshvtwkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ahuB (B:)
    efrpltlppklslsdfnefiqdiirivgsenvevisskdqivdgsymkpththdphhvmd
    qdyflasaivaprnvadvqsivglankfsfplwpisigrnsgyggaaprvsgsvvldmgk
    nmnrvlevnvegaycvvepgvtyhdlhnyleannlrdklwldvpdlgggsvlgnavergv
    gytpygdhwmmhsgmevvlangellrtgmgalpdpkrpetmglkpedqpwskiahlfpyg
    fgpyidglfsqsnmgivtkigiwlmpnprgyqsylitlpkdgdlkqavdiirplrlgmal
    qnvptirhilldaavlgdkrsyssrteplsdeeldkiakqlnlgrwnfygalygpepirr
    vlwetikdafsaipgvkfyfpedtpensvlrvrdktmqgiptydelkwidwlpngahlff
    spiakvsgedammqyavtkkrcqeagldfigtftvgmremhhivcivfnkkdliqkrkvq
    wlmrtliddcaangwgeyrthlafmdqimetynwnnssflrfnevlknavdpngiiapgk
    sgvwpsqyshvtwkl