PDB entry 1ahr

View 1ahr on RCSB PDB site
Description: calmodulin mutant with a two residue deletion in the central helix
Class: calcium-binding protein
Keywords: calmodulin, calcium-binding protein
Deposited on 1997-04-10, released 1997-06-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.211
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: calmodulin
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ahra_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ahrA (A:)
    adqlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgn
    gtidfpefltmmarkmkdseeeireafrvfdkdgngfisaaelrhvmtnlgekltdeevd
    emireadidgdgqvnyeefvtmmtsk