PDB entry 1ahq

View 1ahq on RCSB PDB site
Description: recombinant actophorin
Class: actin binding protein
Keywords: actin binding protein, actophorin
Deposited on 1997-04-10, released 1997-09-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.21
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: actophorin
    Species: Acanthamoeba castellanii [TaxId:5755]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ahqa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ahqA (A:)
    sgiavsddcvqkfnelklghqhryvtfkmnasntevvvehvggpnatyedfksqlperdc
    ryaifdyefqvdggqrnkitfilwapdsapikskmmytstkdsikkklvgiqvevqatda
    aeisedavserakkdvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ahqA (A:)
    giavsddcvqkfnelklghqhryvtfkmnasntevvvehvggpnatyedfksqlperdcr
    yaifdyefqvdggqrnkitfilwapdsapikskmmytstkdsikkklvgiqvevqatdaa
    eisedavserakk