PDB entry 1ahp

View 1ahp on RCSB PDB site
Description: oligosaccharide substrate binding in escherichia coli maltodextrin phsphorylase
Class: ecoli
Keywords: ecoli, phosphorylase, oligosaccharide, induced-fit, substrate, maltodextrin, stacking
Deposited on 1997-04-10, released 1997-10-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.232
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: e.coli maltodextrin phosphorylase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00490 (1-796)
      • engineered (112)
      • conflict (184)
      • conflict (497)
      • conflict (547)
      • conflict (681)
      • conflict (795)
    Domains in SCOPe 2.07: d1ahpa_
  • Chain 'B':
    Compound: e.coli maltodextrin phosphorylase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00490 (1-796)
      • engineered (112)
      • conflict (184)
      • conflict (497)
      • conflict (547)
      • conflict (681)
      • conflict (795)
    Domains in SCOPe 2.07: d1ahpb_
  • Heterogens: MAL, SO4, PLP, GOL

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ahpA (A:)
    msqpifndkqfqealsrqwqryglnsaaemtprqwwlavsealaemlraqpfakpvanqr
    hvnyismefligrltgnnllnlgwyqdvqdslkaydinltdlleeeidpalgagglgrla
    acfldsmatvgqsatgyglnyqyglfrqsfvdgkqveapddwhrsnypwfrhnealdvqv
    giggavtkdgrwepeftitgqawdlpvvgyrngvaqplrlwqathahpfdltkfndgdfl
    raeqqginaekltkvlypndnhtagkklrlmqqyfqcacsvadilrrhhlagrelhelad
    yeviqlndthptiaipellrvlidehqmswddawaitsktfaytnhtlmpealerwdvkl
    vkgllprhmqiineintrfktlvektwpgdekvwaklavvhdkqvhmanlcvvggfavng
    vaalhsdlvvkdlfpeyhqlwpnkfhnvtngitprrwikqcnpalaalldkslqkewand
    ldqlinlvkladdakfrdlyrvikqankvrlaefvkvrtgidinpqaifdiqikrlheyk
    rqhlnllrilalykeirenpqadrvprvflfgakaapgyylakniifainkvadvinndp
    lvgdklkvvflpdycvsaaeklipaadiseqistagkeasgtgnmklalngaltvgtldg
    anveiaekvgeenififghtvkqvkailakgydpvkwrkkdkvldavlkelesgkysdgd
    khafdqmlhsigkqggdpylvmadfaayveaqkqvdvlyrdqeawtraailntarcgmfs
    sdrsirdyqariwqaar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ahpA (A:)
    sqpifndkqfqealsrqwqryglnsaaemtprqwwlavsealaemlraqpfakpvanqrh
    vnyismefligrltgnnllnlgwyqdvqdslkaydinltdlleeeidpalgagglgrlaa
    cfldsmatvgqsatgyglnyqyglfrqsfvdgkqveapddwhrsnypwfrhnealdvqvg
    iggavtkdgrwepeftitgqawdlpvvgyrngvaqplrlwqathahpfdltkfndgdflr
    aeqqginaekltkvlypndnhtagkklrlmqqyfqcacsvadilrrhhlagrelhelady
    eviqlndthptiaipellrvlidehqmswddawaitsktfaytnhtlmpealerwdvklv
    kgllprhmqiineintrfktlvektwpgdekvwaklavvhdkqvhmanlcvvggfavngv
    aalhsdlvvkdlfpeyhqlwpnkfhnvtngitprrwikqcnpalaalldkslqkewandl
    dqlinlvkladdakfrdlyrvikqankvrlaefvkvrtgidinpqaifdiqikrlheykr
    qhlnllrilalykeirenpqadrvprvflfgakaapgyylakniifainkvadvinndpl
    vgdklkvvflpdycvsaaeklipaadiseqistagkeasgtgnmklalngaltvgtldga
    nveiaekvgeenififghtvkqvkailakgydpvkwrkkdkvldavlkelesgkysdgdk
    hafdqmlhsigkqggdpylvmadfaayveaqkqvdvlyrdqeawtraailntarcgmfss
    drsirdyqariwqaar
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ahpB (B:)
    msqpifndkqfqealsrqwqryglnsaaemtprqwwlavsealaemlraqpfakpvanqr
    hvnyismefligrltgnnllnlgwyqdvqdslkaydinltdlleeeidpalgagglgrla
    acfldsmatvgqsatgyglnyqyglfrqsfvdgkqveapddwhrsnypwfrhnealdvqv
    giggavtkdgrwepeftitgqawdlpvvgyrngvaqplrlwqathahpfdltkfndgdfl
    raeqqginaekltkvlypndnhtagkklrlmqqyfqcacsvadilrrhhlagrelhelad
    yeviqlndthptiaipellrvlidehqmswddawaitsktfaytnhtlmpealerwdvkl
    vkgllprhmqiineintrfktlvektwpgdekvwaklavvhdkqvhmanlcvvggfavng
    vaalhsdlvvkdlfpeyhqlwpnkfhnvtngitprrwikqcnpalaalldkslqkewand
    ldqlinlvkladdakfrdlyrvikqankvrlaefvkvrtgidinpqaifdiqikrlheyk
    rqhlnllrilalykeirenpqadrvprvflfgakaapgyylakniifainkvadvinndp
    lvgdklkvvflpdycvsaaeklipaadiseqistagkeasgtgnmklalngaltvgtldg
    anveiaekvgeenififghtvkqvkailakgydpvkwrkkdkvldavlkelesgkysdgd
    khafdqmlhsigkqggdpylvmadfaayveaqkqvdvlyrdqeawtraailntarcgmfs
    sdrsirdyqariwqaar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ahpB (B:)
    sqpifndkqfqealsrqwqryglnsaaemtprqwwlavsealaemlraqpfakpvanqrh
    vnyismefligrltgnnllnlgwyqdvqdslkaydinltdlleeeidpalgagglgrlaa
    cfldsmatvgqsatgyglnyqyglfrqsfvdgkqveapddwhrsnypwfrhnealdvqvg
    iggavtkdgrwepeftitgqawdlpvvgyrngvaqplrlwqathahpfdltkfndgdflr
    aeqqginaekltkvlypndnhtagkklrlmqqyfqcacsvadilrrhhlagrelhelady
    eviqlndthptiaipellrvlidehqmswddawaitsktfaytnhtlmpealerwdvklv
    kgllprhmqiineintrfktlvektwpgdekvwaklavvhdkqvhmanlcvvggfavngv
    aalhsdlvvkdlfpeyhqlwpnkfhnvtngitprrwikqcnpalaalldkslqkewandl
    dqlinlvkladdakfrdlyrvikqankvrlaefvkvrtgidinpqaifdiqikrlheykr
    qhlnllrilalykeirenpqadrvprvflfgakaapgyylakniifainkvadvinndpl
    vgdklkvvflpdycvsaaeklipaadiseqistagkeasgtgnmklalngaltvgtldga
    nveiaekvgeenififghtvkqvkailakgydpvkwrkkdkvldavlkelesgkysdgdk
    hafdqmlhsigkqggdpylvmadfaayveaqkqvdvlyrdqeawtraailntarcgmfss
    drsirdyqariwqaar