PDB entry 1aho

View 1aho on RCSB PDB site
Description: the ab initio structure determination and refinement of a scorpion protein toxin
Class: neurotoxin
Keywords: toxin II, scorpion, ab initio phasing, neurotoxin
Deposited on 1997-04-08, released 1997-10-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 0.96 Å
R-factor: 0.158
AEROSPACI score: 1.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: toxin II
  Species: Androctonus australis [TaxId:70175]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01484 (0-63)
  Domains in SCOPe 2.08: d1ahoa_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ahoA (A:)
  vkdgyivddvnctyfcgrnaycneectklkgesgycqwaspygnacycyklpdhvrtkgp
  grch