PDB entry 1ahn

View 1ahn on RCSB PDB site
Description: e. coli flavodoxin at 2.6 angstroms resolution
Deposited on 1997-04-07, released 1997-12-10
The last revision prior to the SCOP 1.59 freeze date was dated 1997-12-10, with a file datestamp of 1997-12-10.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.19
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.59: d1ahn__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ahn_ (-)
aitgiffgsdtgnteniakmiqkqlgkdvadvhdiaksskedleaydilllgiptwyyge
aqcdwddffptleeidfngklvalfgcgdqedyaeyfcdalgtirdiieprgativghwp
tagyhfeaskgladddhfvglaidedrqpeltaervekwvkqiseelhl