PDB entry 1ahm

View 1ahm on RCSB PDB site
Description: der f 2, the major mite allergen from dermatophagoides farinae, nmr, 10 structures
Class: allergen
Keywords: allergen, immunoglobulin fold
Deposited on 1997-04-07, released 1998-04-08
The last revision prior to the SCOP 1.73 freeze date was dated 1998-04-08, with a file datestamp of 2007-06-04.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: der f 2
    Species: Dermatophagoides farinae
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1ahma_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ahmA (A:)
dqvdvkdcanneikkvmvdgchgsdpciihrgkpftlealfdanqntktakieikasldg
leidvpgidtnachfvkcplvkgqqydikytwnvpkiapksenvvvtvkligdngvlaca
iathgkird