PDB entry 1ahm

View 1ahm on RCSB PDB site
Description: der f 2, the major mite allergen from dermatophagoides farinae, nmr, 10 structures
Deposited on 1997-04-07, released 1998-04-08
The last revision prior to the SCOP 1.57 freeze date was dated 1998-04-08, with a file datestamp of 1998-04-08.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d1ahm__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ahm_ (-)
    dqvdvkdcanneikkvmvdgchgsdpciihrgkpftlealfdanqntktakieikasldg
    leidvpgidtnachfvkcplvkgqqydikytwnvpkiapksenvvvtvkligdngvlaca
    iathgkird