PDB entry 1ahm

View 1ahm on RCSB PDB site
Description: der f 2, the major mite allergen from dermatophagoides farinae, nmr, 10 structures
Class: allergen
Keywords: allergen, immunoglobulin fold
Deposited on 1997-04-07, released 1998-04-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: der f 2
    Species: Dermatophagoides farinae [TaxId:6954]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ahma_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ahmA (A:)
dqvdvkdcanneikkvmvdgchgsdpciihrgkpftlealfdanqntktakieikasldg
leidvpgidtnachfvkcplvkgqqydikytwnvpkiapksenvvvtvkligdngvlaca
iathgkird