PDB entry 1ahl

View 1ahl on RCSB PDB site
Description: anthopleurin-a,nmr, 20 structures
Class: neurotoxin
Keywords: neurotoxin, cardiac stimulant
Deposited on 1994-10-28, released 1995-11-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: anthopleurin-a
  Species: Anthopleura xanthogrammica [TaxId:6112]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01530 (0-48)
  Domains in SCOPe 2.08: d1ahla_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ahlA (A:)
  gvsclcdsdgpsvrgntlsgtlwlypsgcpsgwhnckahgptigwcckq