PDB entry 1ahj

View 1ahj on RCSB PDB site
Description: nitrile hydratase
Class: lyase
Keywords: nitrile hydratase, iron center, non-heme iron, lyase
Deposited on 1997-04-05, released 1998-04-08
The last revision prior to the SCOP 1.75 freeze date was dated 1998-04-08, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.264
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nitrile hydratase (subunit alpha)
    Species: Rhodococcus sp. R312
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13448 (Start-206)
      • conflict (17)
    Domains in SCOP 1.75: d1ahja_
  • Chain 'B':
    Compound: nitrile hydratase (subunit beta)
    Species: Rhodococcus sp. R312
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13449 (0-211)
      • conflict (20)
    Domains in SCOP 1.75: d1ahjb_
  • Chain 'C':
    Compound: nitrile hydratase (subunit alpha)
    Species: Rhodococcus sp. R312
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13448 (Start-206)
      • conflict (17)
    Domains in SCOP 1.75: d1ahjc_
  • Chain 'D':
    Compound: nitrile hydratase (subunit beta)
    Species: Rhodococcus sp. R312
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13449 (0-211)
      • conflict (20)
    Domains in SCOP 1.75: d1ahjd_
  • Chain 'E':
    Compound: nitrile hydratase (subunit alpha)
    Species: Rhodococcus sp. R312
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13448 (Start-206)
      • conflict (17)
    Domains in SCOP 1.75: d1ahje_
  • Chain 'F':
    Compound: nitrile hydratase (subunit beta)
    Species: Rhodococcus sp. R312
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13449 (0-211)
      • conflict (20)
    Domains in SCOP 1.75: d1ahjf_
  • Chain 'G':
    Compound: nitrile hydratase (subunit alpha)
    Species: Rhodococcus sp. R312
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13448 (Start-206)
      • conflict (17)
    Domains in SCOP 1.75: d1ahjg_
  • Chain 'H':
    Compound: nitrile hydratase (subunit beta)
    Species: Rhodococcus sp. R312
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13449 (0-211)
      • conflict (20)
    Domains in SCOP 1.75: d1ahjh_
  • Heterogens: FE

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ahjA (A:)
    msvtidhttenaapaqaavsdrawalfraldgkglvpdgyvegwkktfeedfsprrgael
    varawtdpefrqllltdgtaavaqygylgpqgeyivavedtptlknvivcslcsctawpi
    lglpptwyksfeyrarvvreprkvlsemgteiasdieirvydttaetrymvlpqrpagte
    gwsqeqlqeivtkdcligvaipqvptv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ahjA (A:)
    enaapaqaavsdrawalfraldgkglvpdgyvegwkktfeedfsprrgaelvarawtdpe
    frqllltdgtaavaqygylgpqgeyivavedtptlknvivcslcsctawpilglpptwyk
    sfeyrarvvreprkvlsemgteiasdieirvydttaetrymvlpqrpagtegwsqeqlqe
    ivtkdcligvaipqvptv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ahjB (B:)
    mdgvhdlagvqgfgkvphtvdadigptfhaewehlpyslmfagvaelgafsvdevryvve
    rmeprhymmtpyyeryvigvatlmvekgiltqdeleslaggpfplsrpsesegrpapvet
    ttfevgqrvrvrdeyvpghirmpaycrgrvgtishrttekwpfpdaighgrndageepty
    hvkfaaeelfgsdtdggsvvvdlfegylepaa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ahjC (C:)
    msvtidhttenaapaqaavsdrawalfraldgkglvpdgyvegwkktfeedfsprrgael
    varawtdpefrqllltdgtaavaqygylgpqgeyivavedtptlknvivcslcsctawpi
    lglpptwyksfeyrarvvreprkvlsemgteiasdieirvydttaetrymvlpqrpagte
    gwsqeqlqeivtkdcligvaipqvptv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ahjC (C:)
    enaapaqaavsdrawalfraldgkglvpdgyvegwkktfeedfsprrgaelvarawtdpe
    frqllltdgtaavaqygylgpqgeyivavedtptlknvivcslcsctawpilglpptwyk
    sfeyrarvvreprkvlsemgteiasdieirvydttaetrymvlpqrpagtegwsqeqlqe
    ivtkdcligvaipqvptv
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ahjD (D:)
    mdgvhdlagvqgfgkvphtvdadigptfhaewehlpyslmfagvaelgafsvdevryvve
    rmeprhymmtpyyeryvigvatlmvekgiltqdeleslaggpfplsrpsesegrpapvet
    ttfevgqrvrvrdeyvpghirmpaycrgrvgtishrttekwpfpdaighgrndageepty
    hvkfaaeelfgsdtdggsvvvdlfegylepaa
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1ahjE (E:)
    msvtidhttenaapaqaavsdrawalfraldgkglvpdgyvegwkktfeedfsprrgael
    varawtdpefrqllltdgtaavaqygylgpqgeyivavedtptlknvivcslcsctawpi
    lglpptwyksfeyrarvvreprkvlsemgteiasdieirvydttaetrymvlpqrpagte
    gwsqeqlqeivtkdcligvaipqvptv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ahjE (E:)
    enaapaqaavsdrawalfraldgkglvpdgyvegwkktfeedfsprrgaelvarawtdpe
    frqllltdgtaavaqygylgpqgeyivavedtptlknvivcslcsctawpilglpptwyk
    sfeyrarvvreprkvlsemgteiasdieirvydttaetrymvlpqrpagtegwsqeqlqe
    ivtkdcligvaipqvptv
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ahjF (F:)
    mdgvhdlagvqgfgkvphtvdadigptfhaewehlpyslmfagvaelgafsvdevryvve
    rmeprhymmtpyyeryvigvatlmvekgiltqdeleslaggpfplsrpsesegrpapvet
    ttfevgqrvrvrdeyvpghirmpaycrgrvgtishrttekwpfpdaighgrndageepty
    hvkfaaeelfgsdtdggsvvvdlfegylepaa
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1ahjG (G:)
    msvtidhttenaapaqaavsdrawalfraldgkglvpdgyvegwkktfeedfsprrgael
    varawtdpefrqllltdgtaavaqygylgpqgeyivavedtptlknvivcslcsctawpi
    lglpptwyksfeyrarvvreprkvlsemgteiasdieirvydttaetrymvlpqrpagte
    gwsqeqlqeivtkdcligvaipqvptv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ahjG (G:)
    enaapaqaavsdrawalfraldgkglvpdgyvegwkktfeedfsprrgaelvarawtdpe
    frqllltdgtaavaqygylgpqgeyivavedtptlknvivcslcsctawpilglpptwyk
    sfeyrarvvreprkvlsemgteiasdieirvydttaetrymvlpqrpagtegwsqeqlqe
    ivtkdcligvaipqvptv
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ahjH (H:)
    mdgvhdlagvqgfgkvphtvdadigptfhaewehlpyslmfagvaelgafsvdevryvve
    rmeprhymmtpyyeryvigvatlmvekgiltqdeleslaggpfplsrpsesegrpapvet
    ttfevgqrvrvrdeyvpghirmpaycrgrvgtishrttekwpfpdaighgrndageepty
    hvkfaaeelfgsdtdggsvvvdlfegylepaa