PDB entry 1ahi

View 1ahi on RCSB PDB site
Description: 7 alpha-hydroxysteroid dehydrogenase complexed with nadh and 7-oxo glycochenodeoxycholic acid
Class: oxidoreductase
Keywords: oxidoreductase, short-chain dehydrogenase/reductase,
Deposited on 1995-08-25, released 1996-10-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-10-30, with a file datestamp of 2013-10-25.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.18
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 7 alpha-hydroxysteroid dehydrogenase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ahia_
  • Chain 'B':
    Compound: 7 alpha-hydroxysteroid dehydrogenase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ahib_
  • Heterogens: CHO, NAI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ahiA (A:)
    mfnsdnlrldgkcaiitgagagigkeiaitfatagasvvvsdinadaanhvvdeiqqlgg
    qafacrcditseqelsaladfaisklgkvdilvnnaggggpkpfdmpmadfrrayelnvf
    sffhlsqlvapemekngggviltitsmaaenkninmtsyasskaaashlvrnmafdlgek
    nirvngiapgailtdalksvitpeieqkmlqhtpirrlgqpqdianaalflcspaaswvs
    gqiltvsgggvqeln
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ahiB (B:)
    mfnsdnlrldgkcaiitgagagigkeiaitfatagasvvvsdinadaanhvvdeiqqlgg
    qafacrcditseqelsaladfaisklgkvdilvnnaggggpkpfdmpmadfrrayelnvf
    sffhlsqlvapemekngggviltitsmaaenkninmtsyasskaaashlvrnmafdlgek
    nirvngiapgailtdalksvitpeieqkmlqhtpirrlgqpqdianaalflcspaaswvs
    gqiltvsgggvqeln