PDB entry 1ahh

View 1ahh on RCSB PDB site
Description: 7 alpha-hydroxysteroid dehydrogenase complexed with nad+
Class: oxidoreductase
Keywords: oxidoreductase, short-chain dehydrogenase/reductase, colon bacillus
Deposited on 1995-08-25, released 1996-10-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.182
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 7 alpha-hydroxysteroid dehydrogenase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ahha_
  • Chain 'B':
    Compound: 7 alpha-hydroxysteroid dehydrogenase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ahhb_
  • Heterogens: NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ahhA (A:)
    mfnsdnlrldgkcaiitgagagigkeiaitfatagasvvvsdinadaanhvvdeiqqlgg
    qafacrcditseqelsaladfaisklgkvdilvnnaggggpkpfdmpmadfrrayelnvf
    sffhlsqlvapemekngggviltitsmaaenkninmtsyasskaaashlvrnmafdlgek
    nirvngiapgailtdalksvitpeieqkmlqhtpirrlgqpqdianaalflcspaaswvs
    gqiltvsgggvqeln
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ahhA (A:)
    mfnsdnlrldgkcaiitgagagigkeiaitfatagasvvvsdinadaanhvvdeiqqlgg
    qafacrcditseqelsaladfaisklgkvdilvnnaggggpkpfdmpmadfrrayelnvf
    sffhlsqlvapemekngggviltitsmaaenkninmtsyasskaaashlvrnmafdlgek
    nirvngiapgailtdalksvitpeieqkmlqhtpirrlgqpqdianaalflcspaaswvs
    gqiltvsgggvqe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ahhB (B:)
    mfnsdnlrldgkcaiitgagagigkeiaitfatagasvvvsdinadaanhvvdeiqqlgg
    qafacrcditseqelsaladfaisklgkvdilvnnaggggpkpfdmpmadfrrayelnvf
    sffhlsqlvapemekngggviltitsmaaenkninmtsyasskaaashlvrnmafdlgek
    nirvngiapgailtdalksvitpeieqkmlqhtpirrlgqpqdianaalflcspaaswvs
    gqiltvsgggvqeln
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ahhB (B:)
    mfnsdnlrldgkcaiitgagagigkeiaitfatagasvvvsdinadaanhvvdeiqqlgg
    qafacrcditseqelsaladfaisklgkvdilvnnaggggpkpfdmpmadfrrayelnvf
    sffhlsqlvapemekngggviltitsmaaenkninmtsyasskaaashlvrnmafdlgek
    nirvngiapgailtdalksvitpeieqkmlqhtpirrlgqpqdianaalflcspaaswvs
    gqiltvsgggvqe