PDB entry 1ahg

View 1ahg on RCSB PDB site
Description: aspartate aminotransferase hexamutant
Class: transferase (aminotransferase)
Keywords: transferase (aminotransferase)
Deposited on 1995-02-22, released 1995-09-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.25
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aspartate aminotransferase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00509 (0-395)
      • conflict (34)
      • conflict (36)
      • conflict (42)
      • conflict (63)
      • conflict (103)
      • conflict (284)
    Domains in SCOPe 2.07: d1ahga_
  • Chain 'B':
    Compound: aspartate aminotransferase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00509 (0-395)
      • conflict (34)
      • conflict (36)
      • conflict (42)
      • conflict (63)
      • conflict (103)
      • conflict (284)
    Domains in SCOPe 2.07: d1ahgb_
  • Chain 'C':
    Compound: phospho-5'-pyridoxyl tyrosine
    Species: Escherichia coli [TaxId:562]
  • Chain 'D':
    Compound: phospho-5'-pyridoxyl tyrosine
    Species: Escherichia coli [TaxId:562]
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ahgA (A:)
    mfenitaapadpilgladlfraderpgkinlgiglyydetgkipvltsvkkaeqyllene
    ttklylgidgipefgrctqellfgkgsalindkrartaqtpggsgalrvaadflakntsv
    krvwvsnpswpnhksvfnsaglevreyayydaenhtldfdalinslneaqagdvvlfhgc
    chnptgidptleqwqtlaqlsvekgwlplfdfayqgfargleedaeglrafaamhkeliv
    assysknfglynervgactlvaadsetvdrafsqmkaairanyssppahgasvvatilsn
    dalraiweqeltdmrqriqrmrqlfvntlqekganrdfsfiikqngmfsfsgltkeqvlr
    lreefgvyavasgrvnvagmtpdnmaplceaivavl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ahgB (B:)
    mfenitaapadpilgladlfraderpgkinlgiglyydetgkipvltsvkkaeqyllene
    ttklylgidgipefgrctqellfgkgsalindkrartaqtpggsgalrvaadflakntsv
    krvwvsnpswpnhksvfnsaglevreyayydaenhtldfdalinslneaqagdvvlfhgc
    chnptgidptleqwqtlaqlsvekgwlplfdfayqgfargleedaeglrafaamhkeliv
    assysknfglynervgactlvaadsetvdrafsqmkaairanyssppahgasvvatilsn
    dalraiweqeltdmrqriqrmrqlfvntlqekganrdfsfiikqngmfsfsgltkeqvlr
    lreefgvyavasgrvnvagmtpdnmaplceaivavl
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.