PDB entry 1ahb

View 1ahb on RCSB PDB site
Description: the n-glycosidase mechanism of ribosome-inactivating proteins implied by crystal structures of alpha-momorcharin
Class: glycosidase
Keywords: glycosidase
Deposited on 1994-01-07, released 1994-06-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.175
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-momorcharin
    Species: Momordica charantia [TaxId:3673]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ahba_
  • Heterogens: FMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ahbA (A:)
    dvsfrlsgadprsygmfikdlrnalpfrekvyniplllpsvsgagryllmhlfnydgkti
    tvavdvtnvyimgyladttsyffnepaaelasqyvfrdarrkitlpysgnyerlqiaagk
    prekipiglpaldsaistllhydstaaagallvliqttaeaarfkyieqqiqerayrdev
    pslatislenswsglskqiqlaqgnngifrtpivlvdnkgnrvqitnvtskvvtsniqll
    lntrni