PDB entry 1ah9

View 1ah9 on RCSB PDB site
Description: the structure of the translational initiation factor if1 from escherichia coli, nmr, 19 structures
Class: ribosome binding
Keywords: ribosome binding, protein-RNA interaction, ob fold
Deposited on 1997-04-16, released 1997-07-07
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: NMR19
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: initiation factor 1
    Species: ESCHERICHIA COLI
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1ah9a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ah9A (A:)
akedniemqgtvletlpntmfrvelenghvvtahisgkmrknyiriltgdkvtveltpyd
lskgrivfrsr