PDB entry 1ah7

View 1ah7 on RCSB PDB site
Description: phospholipase c from bacillus cereus
Class: hydrolase
Keywords: lipase, phospholipid hydrolysis, hydrolase
Deposited on 1997-04-14, released 1997-12-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-04-18, with a file datestamp of 2018-04-13.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phospholipase c
    Species: Bacillus cereus [TaxId:1396]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ah7a_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ah7A (A:)
wsaedkhkegvnshlwivnraidimsrnttlvkqdrvaqlnewrtelengiyaadyenpy
ydnstfashfydpdngktyipfakqaketgakyfklagesyknkdmkqaffylglslhyl
gdvnqpmhaanftnlsypqgfhskyenfvdtikdnykvtdgngywnwkgtnpeewihgaa
vvakqdysgivndntkdwfvkaavsqeyadkwraevtpmtgkrlmdaqrvtagyiqlwfd
tygdr