PDB entry 1ah5

View 1ah5 on RCSB PDB site
Description: reduced form selenomethionine-labelled hydroxymethylbilane synthase determined by mad
Class: transferase
Keywords: biosynthesis of linear tetrapyrrole, all alpha/beta, transferase
Deposited on 1997-04-13, released 1997-10-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-09-18, with a file datestamp of 2013-09-13.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.168
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hydroxymethylbilane synthase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06983 (Start-312)
      • modified residue (27)
      • modified residue (40)
      • modified residue (81)
      • modified residue (233)
      • modified residue (285)
    Domains in SCOPe 2.07: d1ah5a1, d1ah5a2
  • Heterogens: DPM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ah5A (A:)
    mldnvlriatrqsplalwqahyvkdklmashpglvvelvpmvtrgdvildtplakvggkg
    lfvkelevallenradiavhsmkdvpvefpqglglvticeredprdafvsnnydsldalp
    agsivgtsslrrqcqlaerrpdliirslrgnvgtrlskldngeydaiilavaglkrlgle
    sriraalppeislpavgqgavgiecrlddsrtrellaalnhhetalrvtaeramntrleg
    gcqvpigsyaelidgeiwlralvgapdgsqiirgerrgapqdaeqmgislaeellnngar
    eilaevyngdapa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ah5A (A:)
    dnvlriatrqsplalwqahyvkdklmashpglvvelvpmvtrgdkglfvkelevallenr
    adiavhsmkdvpvefpqglglvticeredprdafvsnnydsldalpagsivgtsslrrqc
    qlaerrpdliirslrgnvgtrlskldngeydaiilavaglkrlglesriraalppeislp
    avgqgavgiecrlddsrtrellaalnhhetalrvtaeramntrleggcqvpigsyaelid
    geiwlralvgapdgsqiirgerrgapqdaeqmgislaeellnngareilaevyngdapa