PDB entry 1ah3

View 1ah3 on RCSB PDB site
Description: aldose reductase complexed with tolrestat inhibitor
Class: oxidoreductase
Keywords: oxidoreductase, aldose reductase, inhibition, diabetes
Deposited on 1997-04-12, released 1998-04-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.207
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aldose reductase
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ah3a_
  • Heterogens: NAP, TOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ah3A (A:)
    ashlvlytgakmpilglgtwksppgkvteavkvaidlgyrhidcahvyqnenevglglqe
    klqgqvvkredlfivsklwctdheknlvkgacqttlrdlkldyldlylihwptgfkpgkd
    pfpldgdgnvvpdesdfvetweameelvdeglvkaigvsnfnhlqvekilnkpglkykpa
    vnqievhpyltqeklieyckskgivvtaysplgspdrpwakpedpslledprikaiaaky
    nkttaqvlirfpmqrnlivipksvtperiaenfqvfdfelspedmntllsynrnwrvcal
    mscashkdypfheey