PDB entry 1ah2

View 1ah2 on RCSB PDB site
Description: serine protease pb92 from bacillus alcalophilus, nmr, 18 structures
Class: serine protease
Keywords: serine protease, subtilase, industrial enzyme, maxacal(tm), application in washing powders
Deposited on 1997-04-11, released 1998-04-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serine protease pb92
    Species: Bacillus alcalophilus [TaxId:1445]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ah2a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ah2A (A:)
aqsvpwgisrvqapaahnrgltgsgvkvavldtgisthpdlnirggasfvpgepstqdgn
ghgthvagtiaalnnsigvlgvapnaelyavkvlgasgsgsvssiaqglewagnngmhva
nlslgspspsatleqavnsatsrgvlvvaasgnsgagsisyparyanamavgatdqnnnr
asfsqygagldivapgvnvqstypgstyaslngtsmatphvagaaalvkqknpswsnvqi
rnhlkntatslgstnlygsglvnaeaatr