PDB entry 1agy

View 1agy on RCSB PDB site
Description: The 1.15 angstrom refined structure of fusarium solani pisi cutinase
Class: serine esterase
Keywords: hydrolase, serine esterase, glycoprotein
Deposited on 1997-03-26, released 1998-04-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-09-29, with a file datestamp of 2009-09-25.
Experiment type: XRAY
Resolution: 1.15 Å
R-factor: 0.175
AEROSPACI score: 0.86 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cutinase
    Species: Nectria haematococca mpVI [TaxId:70791]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1agya_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1agyA (A:)
    lgrttrddlingnsascrdvifiyargstetgnlgtlgpsiasnlesafgkdgvwiqgvg
    gayratlgdnalprgtssaairemlglfqqantkcpdatliaggysqgaalaaasiedld
    sairdkiagtvlfgytknlqnrgripnypadrtkvfcntgdlvctgslivaaphlaygpd
    argpapefliekvravrgsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1agyA (A:)
    rttrddlingnsascrdvifiyargstetgnlgtlgpsiasnlesafgkdgvwiqgvgga
    yratlgdnalprgtssaairemlglfqqantkcpdatliaggysqgaalaaasiedldsa
    irdkiagtvlfgytknlqnrgripnypadrtkvfcntgdlvctgslivaaphlaygpdar
    gpapefliekvravrgs