PDB entry 1agx

View 1agx on RCSB PDB site
Description: refined crystal structure of acinetobacter glutaminasificans glutaminase-asparaginase
Class: bacterial amidohydrolase
Keywords: bacterial amidohydrolase
Deposited on 1994-07-13, released 1994-12-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.171
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutaminase-asparaginase
    Species: Acinetobacter glutaminasificans [TaxId:474]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1agxa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1agxA (A:)
    knnvvivatggtiagagasstnsatysaakvpvdalikavpqvndlanitgiqalqvase
    sitdkellslarqvndlvkkpsvngvvithgtdtmeetafflnlvvhtdkpivlvgsmrp
    stalsadgplnlysavalassneaknkgvmvlmndsifaardvtkginihthafvsqwga
    lgtlvegkpywfrssvkkhtnnsefniekiqgdalpgvqivygsdnmmpdayqafakagv
    kaiihagtgngsmanylvpevrklhdeqglqivrssrvaqgfvlrnaeqpddkygwiaah
    dlnpqkarllmalaltktndakeiqnmfwny