PDB entry 1agt

View 1agt on RCSB PDB site
Description: solution structure of the potassium channel inhibitor agitoxin 2: caliper for probing channel geometry
Class: neurotoxin
Keywords: potassium channel blocker, neurotoxin
Deposited on 1995-04-14, released 1995-07-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: agitoxin 2
  Species: Leiurus quinquestriatus [TaxId:6884]
  Gene: AGTX2
  Database cross-references and differences (RAF-indexed):
  • Uniprot P46111 (0-37)
  Domains in SCOPe 2.08: d1agta_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1agtA (A:)
  gvpinvsctgspqcikpckdagmrfgkcmnrkchctpk