PDB entry 1agq

View 1agq on RCSB PDB site
Description: glial cell-derived neurotrophic factor from rat
Class: growth factor
Keywords: growth factor, neurotrophic factor, cystine knot
Deposited on 1997-03-25, released 1997-06-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.203
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glial cell-derived neurotrophic factor
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1agqa_
  • Chain 'B':
    Compound: glial cell-derived neurotrophic factor
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1agqb_
  • Chain 'C':
    Compound: glial cell-derived neurotrophic factor
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1agqc_
  • Chain 'D':
    Compound: glial cell-derived neurotrophic factor
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1agqd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1agqA (A:)
    mspdkqaaalprrernrqaaaaspensrgkgrrgqrgknrgcvltaihlnvtdlglgyet
    keelifrycsgsceaaetmydkilknlsrsrrltsdkvgqaccrpvafdddlsflddslv
    yhilrkhsakrcgci
    

    Sequence, based on observed residues (ATOM records): (download)
    >1agqA (A:)
    nrgcvltaihlnvtdlglgyetkeelifrycsgsceaaetmydkilknlsrsrvgqaccr
    pvafdddlsflddslvyhilrkhsakrcgci
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1agqB (B:)
    mspdkqaaalprrernrqaaaaspensrgkgrrgqrgknrgcvltaihlnvtdlglgyet
    keelifrycsgsceaaetmydkilknlsrsrrltsdkvgqaccrpvafdddlsflddslv
    yhilrkhsakrcgci
    

    Sequence, based on observed residues (ATOM records): (download)
    >1agqB (B:)
    knrgcvltaihlnvtdlglgyetkeelifrycsgsceaaetmydkilknlsrsrrltsvg
    qaccrpvafdddlsflddslvyhilrkhsakrcgci
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1agqC (C:)
    mspdkqaaalprrernrqaaaaspensrgkgrrgqrgknrgcvltaihlnvtdlglgyet
    keelifrycsgsceaaetmydkilknlsrsrrltsdkvgqaccrpvafdddlsflddslv
    yhilrkhsakrcgci
    

    Sequence, based on observed residues (ATOM records): (download)
    >1agqC (C:)
    gcvltaihlnvtdlglgyetkeelifrycsgsceaaetmydkilknlsrsrrlvgqaccr
    pvafdddlsflddslvyhilrkhsakrcgci
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1agqD (D:)
    mspdkqaaalprrernrqaaaaspensrgkgrrgqrgknrgcvltaihlnvtdlglgyet
    keelifrycsgsceaaetmydkilknlsrsrrltsdkvgqaccrpvafdddlsflddslv
    yhilrkhsakrcgci
    

    Sequence, based on observed residues (ATOM records): (download)
    >1agqD (D:)
    gcvltaihlnvtdlglgyetkeelifrycsgsceaaetmydkilknlsrsrrltsdkvgq
    accrpvafdddlsflddslvyhilrkhsakrcgci