PDB entry 1agn

View 1agn on RCSB PDB site
Description: x-ray structure of human sigma alcohol dehydrogenase
Deposited on 1996-06-04, released 1997-03-12
The last revision prior to the SCOP 1.55 freeze date was dated 1997-03-12, with a file datestamp of 1997-03-13.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.225
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1agnA (A:)
    gtagkvikckaavlweqkqpfsieeievappktkevrikilatgicrtddhvikgtmvsk
    fpvivgheatgivesigegvttvkpgdkviplflpqcrecnacrnpdgnlcirsditgrg
    vladgttrftckgkpvhhfmntstfteytvvdessvakiddaappekvcligcgfstgyg
    aavktgkvkpgstcvvfglggvglsvimgcksagasriigidlnkdkfekamavgateci
    spkdstkpisevlsemtgnnvgytfevighletmidalaschmnygtsvvvgvppsakml
    tydpmllftgrtwkgcvfgglksrddvpklvteflakkfdldqlithvlpfkkisegfel
    lnsgqsirtvltf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1agnB (B:)
    gtagkvikckaavlweqkqpfsieeievappktkevrikilatgicrtddhvikgtmvsk
    fpvivgheatgivesigegvttvkpgdkviplflpqcrecnacrnpdgnlcirsditgrg
    vladgttrftckgkpvhhfmntstfteytvvdessvakiddaappekvcligcgfstgyg
    aavktgkvkpgstcvvfglggvglsvimgcksagasriigidlnkdkfekamavgateci
    spkdstkpisevlsemtgnnvgytfevighletmidalaschmnygtsvvvgvppsakml
    tydpmllftgrtwkgcvfgglksrddvpklvteflakkfdldqlithvlpfkkisegfel
    lnsgqsirtvltf
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1agnC (C:)
    gtagkvikckaavlweqkqpfsieeievappktkevrikilatgicrtddhvikgtmvsk
    fpvivgheatgivesigegvttvkpgdkviplflpqcrecnacrnpdgnlcirsditgrg
    vladgttrftckgkpvhhfmntstfteytvvdessvakiddaappekvcligcgfstgyg
    aavktgkvkpgstcvvfglggvglsvimgcksagasriigidlnkdkfekamavgateci
    spkdstkpisevlsemtgnnvgytfevighletmidalaschmnygtsvvvgvppsakml
    tydpmllftgrtwkgcvfgglksrddvpklvteflakkfdldqlithvlpfkkisegfel
    lnsgqsirtvltf
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1agnD (D:)
    gtagkvikckaavlweqkqpfsieeievappktkevrikilatgicrtddhvikgtmvsk
    fpvivgheatgivesigegvttvkpgdkviplflpqcrecnacrnpdgnlcirsditgrg
    vladgttrftckgkpvhhfmntstfteytvvdessvakiddaappekvcligcgfstgyg
    aavktgkvkpgstcvvfglggvglsvimgcksagasriigidlnkdkfekamavgateci
    spkdstkpisevlsemtgnnvgytfevighletmidalaschmnygtsvvvgvppsakml
    tydpmllftgrtwkgcvfgglksrddvpklvteflakkfdldqlithvlpfkkisegfel
    lnsgqsirtvltf