PDB entry 1agn

View 1agn on RCSB PDB site
Description: x-ray structure of human sigma alcohol dehydrogenase
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 1996-06-04, released 1997-03-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.225
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: human sigma alcohol dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Gene: HUMAN SIGMA CDNA (ADH7)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1agna1, d1agna2
  • Chain 'B':
    Compound: human sigma alcohol dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Gene: HUMAN SIGMA CDNA (ADH7)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1agnb1, d1agnb2
  • Chain 'C':
    Compound: human sigma alcohol dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Gene: HUMAN SIGMA CDNA (ADH7)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1agnc1, d1agnc2
  • Chain 'D':
    Compound: human sigma alcohol dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Gene: HUMAN SIGMA CDNA (ADH7)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1agnd1, d1agnd2
  • Heterogens: ZN, ACT, NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1agnA (A:)
    gtagkvikckaavlweqkqpfsieeievappktkevrikilatgicrtddhvikgtmvsk
    fpvivgheatgivesigegvttvkpgdkviplflpqcrecnacrnpdgnlcirsditgrg
    vladgttrftckgkpvhhfmntstfteytvvdessvakiddaappekvcligcgfstgyg
    aavktgkvkpgstcvvfglggvglsvimgcksagasriigidlnkdkfekamavgateci
    spkdstkpisevlsemtgnnvgytfevighletmidalaschmnygtsvvvgvppsakml
    tydpmllftgrtwkgcvfgglksrddvpklvteflakkfdldqlithvlpfkkisegfel
    lnsgqsirtvltf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1agnB (B:)
    gtagkvikckaavlweqkqpfsieeievappktkevrikilatgicrtddhvikgtmvsk
    fpvivgheatgivesigegvttvkpgdkviplflpqcrecnacrnpdgnlcirsditgrg
    vladgttrftckgkpvhhfmntstfteytvvdessvakiddaappekvcligcgfstgyg
    aavktgkvkpgstcvvfglggvglsvimgcksagasriigidlnkdkfekamavgateci
    spkdstkpisevlsemtgnnvgytfevighletmidalaschmnygtsvvvgvppsakml
    tydpmllftgrtwkgcvfgglksrddvpklvteflakkfdldqlithvlpfkkisegfel
    lnsgqsirtvltf
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1agnC (C:)
    gtagkvikckaavlweqkqpfsieeievappktkevrikilatgicrtddhvikgtmvsk
    fpvivgheatgivesigegvttvkpgdkviplflpqcrecnacrnpdgnlcirsditgrg
    vladgttrftckgkpvhhfmntstfteytvvdessvakiddaappekvcligcgfstgyg
    aavktgkvkpgstcvvfglggvglsvimgcksagasriigidlnkdkfekamavgateci
    spkdstkpisevlsemtgnnvgytfevighletmidalaschmnygtsvvvgvppsakml
    tydpmllftgrtwkgcvfgglksrddvpklvteflakkfdldqlithvlpfkkisegfel
    lnsgqsirtvltf
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1agnD (D:)
    gtagkvikckaavlweqkqpfsieeievappktkevrikilatgicrtddhvikgtmvsk
    fpvivgheatgivesigegvttvkpgdkviplflpqcrecnacrnpdgnlcirsditgrg
    vladgttrftckgkpvhhfmntstfteytvvdessvakiddaappekvcligcgfstgyg
    aavktgkvkpgstcvvfglggvglsvimgcksagasriigidlnkdkfekamavgateci
    spkdstkpisevlsemtgnnvgytfevighletmidalaschmnygtsvvvgvppsakml
    tydpmllftgrtwkgcvfgglksrddvpklvteflakkfdldqlithvlpfkkisegfel
    lnsgqsirtvltf