PDB entry 1agm

View 1agm on RCSB PDB site
Description: Refined structure for the complex of acarbose with glucoamylase from Aspergillus awamori var. x100 to 2.4 angstroms resolution
Class: hydrolase
Keywords: hydrolase
Deposited on 1994-05-13, released 1994-09-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glucoamylase-471
    Species: Aspergillus awamori [TaxId:105351]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23176 (0-469)
      • conflict (57)
      • conflict (59)
      • conflict (115)
    Domains in SCOPe 2.07: d1agma_
  • Heterogens: NAG, BMA, MAN, ACR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1agmA (A:)
    atldswlsneatvartailnnigadgawvsgadsgivvaspstdnpdyfytwtrdsglvi
    ktlvdlfrngdtdllstiehyissqaiiqgvsnpsgdlssgglgepkfnvdetaytgswg
    rpqrdgpalratamigfgqwlldngytsaateivwplvrndlsyvaqywnqtgydlweev
    ngssfftiavqhralvegsafatavgsscswcdsqapqilcylqsfwtgsyilanfdssr
    sgkdtntllgsihtfdpeagcddstfqpcspralanhkevvdsfrsiytlndglsdseav
    avgrypedsyyngnpwflctlaaaeqlydalyqwdkqgsleitdvsldffkalysgaatg
    tyssssstyssivsavktfadgfvsivethaasngslseqfdksdgdelsardltwsyaa
    lltannrrnsvvppswgetsassvpgtcaatsasgtyssvtvtswpsiva