PDB entry 1agi

View 1agi on RCSB PDB site
Description: crystal structure of bovine angiogenin at 1.5 angstroms resolution
Class: endonuclease
Keywords: endonuclease
Deposited on 1995-01-06, released 1996-04-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.203
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: angiogenin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1agia_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1agiA (A:)
    aqddyryihfltqhydakpkgrndeycfnmmknrrltrpckdrntfihgnkndikaiced
    rngqpyrgdlrisksefqitickhkggssrppcrygatedsrvivvgcenglpvhfdesf
    itprh