PDB entry 1agg

View 1agg on RCSB PDB site
Description: the solution structure of omega-aga-ivb, a p-type calcium channel antagonist from the venom of agelenopsis aperta
Class: neurotoxin
Keywords: neurotoxin, p-type calcium channel antagonist
Deposited on 1995-11-03, released 1996-03-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-02-05, with a file datestamp of 2014-01-31.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: omega-agatoxin-ivb
  Species: Agelenopsis aperta [TaxId:6908]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P37045 (0-47)
  Domains in SCOPe 2.08: d1agga_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1aggA (A:)
  ednciaedygkctwggtkccrgrpcrcsmigtncectprlimeglsfa