PDB entry 1ag9

View 1ag9 on RCSB PDB site
Description: flavodoxins that are required for enzyme activation: the structure of oxidized flavodoxin from escherichia coli at 1.8 angstroms resolution.
Class: electron transport
Keywords: electron transport, reductive activation, flavodoxin, escherichia coli
Deposited on 1997-04-04, released 1997-12-24
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.196
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: flavodoxin
    Species: Escherichia coli [TaxId:562]
    Gene: FLDA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1ag9a_
  • Chain 'B':
    Compound: flavodoxin
    Species: Escherichia coli [TaxId:562]
    Gene: FLDA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1ag9b_
  • Heterogens: CA, CL, NA, FMN, BTB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ag9A (A:)
    aitgiffgsdtgnteniakmiqkqlgkdvadvhdiaksskedleaydilllgiptwyyge
    aqcdwddffptleeidfngklvalfgcgdqedyaeyfcdalgtirdiieprgativghwp
    tagyhfeaskgladddhfvglaidedrqpeltaervekwvkqiseelhldeilna
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ag9B (B:)
    aitgiffgsdtgnteniakmiqkqlgkdvadvhdiaksskedleaydilllgiptwyyge
    aqcdwddffptleeidfngklvalfgcgdqedyaeyfcdalgtirdiieprgativghwp
    tagyhfeaskgladddhfvglaidedrqpeltaervekwvkqiseelhldeilna