PDB entry 1ag8

View 1ag8 on RCSB PDB site
Description: aldehyde dehydrogenase from bovine mitochondria
Class: oxidoreductase
Keywords: oxidoreductase, alcohol metabolism, aldehyde oxidation, alpha/beta domain, dehydrogenase
Deposited on 1997-04-03, released 1997-10-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.217
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aldehyde dehydrogenase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ag8a_
  • Chain 'B':
    Compound: aldehyde dehydrogenase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ag8b_
  • Chain 'C':
    Compound: aldehyde dehydrogenase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ag8c_
  • Chain 'D':
    Compound: aldehyde dehydrogenase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ag8d_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ag8A (A:)
    saatqavptpnqqpevlynqifinnewhdavskktfptvnpstgdvichvaegdkadvdr
    avkaaraafqlgspwrrmdasergrllnrladlierdrtylaaletldngkpyiisylvd
    ldmvlkclryyagwadkyhgktipidgdyfsytrhepvgvcgqiipwnfpllmqawklgp
    alatgnvvvmkvaeqtpltalyvanlikeagfppgvvnvipgfgptagaaiashedvdkv
    aftgstevghliqvaagksnlkrvtleiggkspniimsdadmdwaveqahfalffnqgqc
    ccagsrtfvqediyaefversvaraksrvvgnpfdsrteqgpqvdetqfkkvlgyiksgk
    eeglkllcgggaaadrgyfiqptvfgdlqdgmtiakeeifgpvmqilkfksmeevvgran
    nskyglaaavftkdldkanylsqalqagtvwvncydvfgaqspfggyklsgsgrelgeyg
    lqaytevktvtvrvpqkns
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ag8A (A:)
    vptpnqqpevlynqifinnewhdavskktfptvnpstgdvichvaegdkadvdravkaar
    aafqlgspwrrmdasergrllnrladlierdrtylaaletldngkpyiisylvdldmvlk
    clryyagwadkyhgktipidgdyfsytrhepvgvcgqiipwnfpllmqawklgpalatgn
    vvvmkvaeqtpltalyvanlikeagfppgvvnvipgfgptagaaiashedvdkvaftgst
    evghliqvaagksnlkrvtleiggkspniimsdadmdwaveqahfalffnqgqcccagsr
    tfvqediyaefversvaraksrvvgnpfdsrteqgpqvdetqfkkvlgyiksgkeeglkl
    lcgggaaadrgyfiqptvfgdlqdgmtiakeeifgpvmqilkfksmeevvgrannskygl
    aaavftkdldkanylsqalqagtvwvncydvfgaqspfggyklsgsgrelgeyglqayte
    vktvtvrvpqkns
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ag8B (B:)
    saatqavptpnqqpevlynqifinnewhdavskktfptvnpstgdvichvaegdkadvdr
    avkaaraafqlgspwrrmdasergrllnrladlierdrtylaaletldngkpyiisylvd
    ldmvlkclryyagwadkyhgktipidgdyfsytrhepvgvcgqiipwnfpllmqawklgp
    alatgnvvvmkvaeqtpltalyvanlikeagfppgvvnvipgfgptagaaiashedvdkv
    aftgstevghliqvaagksnlkrvtleiggkspniimsdadmdwaveqahfalffnqgqc
    ccagsrtfvqediyaefversvaraksrvvgnpfdsrteqgpqvdetqfkkvlgyiksgk
    eeglkllcgggaaadrgyfiqptvfgdlqdgmtiakeeifgpvmqilkfksmeevvgran
    nskyglaaavftkdldkanylsqalqagtvwvncydvfgaqspfggyklsgsgrelgeyg
    lqaytevktvtvrvpqkns
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ag8B (B:)
    vptpnqqpevlynqifinnewhdavskktfptvnpstgdvichvaegdkadvdravkaar
    aafqlgspwrrmdasergrllnrladlierdrtylaaletldngkpyiisylvdldmvlk
    clryyagwadkyhgktipidgdyfsytrhepvgvcgqiipwnfpllmqawklgpalatgn
    vvvmkvaeqtpltalyvanlikeagfppgvvnvipgfgptagaaiashedvdkvaftgst
    evghliqvaagksnlkrvtleiggkspniimsdadmdwaveqahfalffnqgqcccagsr
    tfvqediyaefversvaraksrvvgnpfdsrteqgpqvdetqfkkvlgyiksgkeeglkl
    lcgggaaadrgyfiqptvfgdlqdgmtiakeeifgpvmqilkfksmeevvgrannskygl
    aaavftkdldkanylsqalqagtvwvncydvfgaqspfggyklsgsgrelgeyglqayte
    vktvtvrvpqkns
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ag8C (C:)
    saatqavptpnqqpevlynqifinnewhdavskktfptvnpstgdvichvaegdkadvdr
    avkaaraafqlgspwrrmdasergrllnrladlierdrtylaaletldngkpyiisylvd
    ldmvlkclryyagwadkyhgktipidgdyfsytrhepvgvcgqiipwnfpllmqawklgp
    alatgnvvvmkvaeqtpltalyvanlikeagfppgvvnvipgfgptagaaiashedvdkv
    aftgstevghliqvaagksnlkrvtleiggkspniimsdadmdwaveqahfalffnqgqc
    ccagsrtfvqediyaefversvaraksrvvgnpfdsrteqgpqvdetqfkkvlgyiksgk
    eeglkllcgggaaadrgyfiqptvfgdlqdgmtiakeeifgpvmqilkfksmeevvgran
    nskyglaaavftkdldkanylsqalqagtvwvncydvfgaqspfggyklsgsgrelgeyg
    lqaytevktvtvrvpqkns
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ag8C (C:)
    vptpnqqpevlynqifinnewhdavskktfptvnpstgdvichvaegdkadvdravkaar
    aafqlgspwrrmdasergrllnrladlierdrtylaaletldngkpyiisylvdldmvlk
    clryyagwadkyhgktipidgdyfsytrhepvgvcgqiipwnfpllmqawklgpalatgn
    vvvmkvaeqtpltalyvanlikeagfppgvvnvipgfgptagaaiashedvdkvaftgst
    evghliqvaagksnlkrvtleiggkspniimsdadmdwaveqahfalffnqgqcccagsr
    tfvqediyaefversvaraksrvvgnpfdsrteqgpqvdetqfkkvlgyiksgkeeglkl
    lcgggaaadrgyfiqptvfgdlqdgmtiakeeifgpvmqilkfksmeevvgrannskygl
    aaavftkdldkanylsqalqagtvwvncydvfgaqspfggyklsgsgrelgeyglqayte
    vktvtvrvpqkns
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ag8D (D:)
    saatqavptpnqqpevlynqifinnewhdavskktfptvnpstgdvichvaegdkadvdr
    avkaaraafqlgspwrrmdasergrllnrladlierdrtylaaletldngkpyiisylvd
    ldmvlkclryyagwadkyhgktipidgdyfsytrhepvgvcgqiipwnfpllmqawklgp
    alatgnvvvmkvaeqtpltalyvanlikeagfppgvvnvipgfgptagaaiashedvdkv
    aftgstevghliqvaagksnlkrvtleiggkspniimsdadmdwaveqahfalffnqgqc
    ccagsrtfvqediyaefversvaraksrvvgnpfdsrteqgpqvdetqfkkvlgyiksgk
    eeglkllcgggaaadrgyfiqptvfgdlqdgmtiakeeifgpvmqilkfksmeevvgran
    nskyglaaavftkdldkanylsqalqagtvwvncydvfgaqspfggyklsgsgrelgeyg
    lqaytevktvtvrvpqkns
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ag8D (D:)
    vptpnqqpevlynqifinnewhdavskktfptvnpstgdvichvaegdkadvdravkaar
    aafqlgspwrrmdasergrllnrladlierdrtylaaletldngkpyiisylvdldmvlk
    clryyagwadkyhgktipidgdyfsytrhepvgvcgqiipwnfpllmqawklgpalatgn
    vvvmkvaeqtpltalyvanlikeagfppgvvnvipgfgptagaaiashedvdkvaftgst
    evghliqvaagksnlkrvtleiggkspniimsdadmdwaveqahfalffnqgqcccagsr
    tfvqediyaefversvaraksrvvgnpfdsrteqgpqvdetqfkkvlgyiksgkeeglkl
    lcgggaaadrgyfiqptvfgdlqdgmtiakeeifgpvmqilkfksmeevvgrannskygl
    aaavftkdldkanylsqalqagtvwvncydvfgaqspfggyklsgsgrelgeyglqayte
    vktvtvrvpqkns