PDB entry 1ag7

View 1ag7 on RCSB PDB site
Description: conotoxin gs, nmr, 20 structures
Class: neurotoxin
Keywords: neurotoxin, mu-conotoxin, sodium channel blocker, cystine knot motif
Deposited on 1997-04-03, released 1998-04-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: conotoxin gs
    Species: Conus geographus [TaxId:6491]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15472 (0-33)
      • modified residue (9-10)
      • modified residue (31)
    Domains in SCOPe 2.08: d1ag7a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ag7A (A:)
    acsgrgsrcppqccmglrcgrgnpqkcigahedv