PDB entry 1ag2

View 1ag2 on RCSB PDB site
Description: prion protein domain prp(121-231) from mouse, nmr, 2 minimized average structure
Class: prion protein
Keywords: prion protein, brain, glycoprotein, gpi-anchor
Deposited on 1997-03-31, released 1997-10-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-02-24, with a file datestamp of 2016-02-19.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: major prion protein
    Species: Mus musculus [TaxId:10090]
    Gene: T7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ag2a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ag2A (A:)
    glggymlgsamsrpmihfgndwedryyrenmyrypnqvyyrpvdqysnqnnfvhdcvnit
    ikqhtvttttkgenftetdvkmmervveqmcvtqyqkesqayy