PDB entry 1ag0

View 1ag0 on RCSB PDB site
Description: structure of cys 112 asp azurin from pseudomonas aeruginosa
Deposited on 1997-03-26, released 1997-10-29
The last revision prior to the SCOP 1.55 freeze date was dated 1997-10-29, with a file datestamp of 1997-10-29.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.2
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1ag0a_
  • Chain 'B':
    Domains in SCOP 1.55: d1ag0b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ag0A (A:)
    aaecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgv
    vtdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffdtfpghsa
    lmkgtltlk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ag0B (B:)
    aaecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgv
    vtdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffdtfpghsa
    lmkgtltlk