PDB entry 1ag0

View 1ag0 on RCSB PDB site
Description: structure of cys 112 asp azurin from pseudomonas aeruginosa
Class: electron transport
Keywords: electron transport, copper binding
Deposited on 1997-03-26, released 1997-10-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-05-25, with a file datestamp of 2011-05-20.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.2
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Azurin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00282 (Start-128)
      • engineered (112)
    Domains in SCOPe 2.07: d1ag0a_
  • Chain 'B':
    Compound: Azurin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00282 (Start-128)
      • engineered (112)
    Domains in SCOPe 2.07: d1ag0b_
  • Heterogens: CU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ag0A (A:)
    aaecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgv
    vtdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffdtfpghsa
    lmkgtltlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ag0A (A:)
    aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffdtfpghsal
    mkgtltlk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ag0B (B:)
    aaecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgv
    vtdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffdtfpghsa
    lmkgtltlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ag0B (B:)
    aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffdtfpghsal
    mkgtltlk