PDB entry 1afw

View 1afw on RCSB PDB site
Description: the 1.8 angstrom crystal structure of the dimeric peroxisomal thiolase of saccharomyces cerevisiae
Deposited on 1997-03-15, released 1997-06-16
The last revision prior to the SCOP 1.55 freeze date was dated 1997-06-16, with a file datestamp of 1997-06-17.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.187
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1afwA (A:)
    knsllekrpedvvivaanrsaigkgfkgafkdvntdyllynflnefigrfpeplradlnl
    ieevacgnvlnvgagatehraaclasgipystpfvalnrqcssgltavndiankikvgqi
    diglalgvesmtnnyknvnplgmisseelqknreakkclipmgitnenvaanfkisrkdq
    defaansyqkaykakneglfedeilpiklpdgsicqsdegprpnvtaeslssirpafikd
    rgtttagnasqvsdgvagvllarrsvanqlnlpvlgryidfqtvgvppeimgvgpayaip
    kvleatglqvqdidifeineafaaqalycihklgidlnkvnprggaialghplgctgarq
    vatilrelkkdqigvvsmcigtgmgaaaifike
    

    Sequence, based on observed residues (ATOM records): (download)
    >1afwA (A:)
    knsllekrpedvvivaanrsaigkgfkgafkdvntdyllynflnefigrfpeplradlnl
    ieevacgnvlnvgagatehraaclasgipystpfvalnrqcssgltavndiankikvgqi
    diglalgvesmtnnyknvnplgmisseelqknreakkclipmgitnenvaanfkisrkdq
    defaansyqkaykakneglfedeilpiklpdgsicqsdegprpnvtaeslssirpafigt
    ttagnasqvsdgvagvllarrsvanqlnlpvlgryidfqtvgvppeimgvgpayaipkvl
    eatglqvqdidifeineafaaqalycihklgidlnkvnprggaialghplgctgarqvat
    ilrelkkdqigvvsmcigtgmgaaaifike
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1afwB (B:)
    knsllekrpedvvivaanrsaigkgfkgafkdvntdyllynflnefigrfpeplradlnl
    ieevacgnvlnvgagatehraaclasgipystpfvalnrqcssgltavndiankikvgqi
    diglalgvesmtnnyknvnplgmisseelqknreakkclipmgitnenvaanfkisrkdq
    defaansyqkaykakneglfedeilpiklpdgsicqsdegprpnvtaeslssirpafikd
    rgtttagnasqvsdgvagvllarrsvanqlnlpvlgryidfqtvgvppeimgvgpayaip
    kvleatglqvqdidifeineafaaqalycihklgidlnkvnprggaialghplgctgarq
    vatilrelkkdqigvvsmcigtgmgaaaifike