PDB entry 1afv

View 1afv on RCSB PDB site
Description: hiv-1 capsid protein (p24) complex with fab25.3
Class: Viral protein/Immune system
Keywords: COMPLEX (VIRAL CAPSID/IMMUNOGLOBULIN), HIV, CAPSID PROTEIN, P24, Viral protein/Immune system COMPLEX
Deposited on 1997-03-14, released 1997-08-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.7 Å
R-factor: 0.217
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: human immunodeficiency virus type 1 capsid protein
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1afva_
  • Chain 'B':
    Compound: human immunodeficiency virus type 1 capsid protein
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1afvb_
  • Chain 'H':
    Compound: antibody fab25.3 fragment (heavy chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99LC4 (0-218)
      • conflict (0)
      • conflict (2)
      • conflict (4-6)
      • conflict (8-9)
      • conflict (15)
      • conflict (19)
      • conflict (30-31)
      • conflict (33-34)
      • conflict (36)
      • conflict (42)
      • conflict (49)
      • conflict (51)
      • conflict (53-54)
      • conflict (56)
      • conflict (71)
      • conflict (80-81)
      • conflict (94)
      • conflict (98-99)
      • conflict (103)
      • conflict (108)
      • conflict (115)
    Domains in SCOPe 2.07: d1afvh1, d1afvh2
  • Chain 'K':
    Compound: antibody fab25.3 fragment (heavy chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99LC4 (0-218)
      • conflict (0)
      • conflict (2)
      • conflict (4-6)
      • conflict (8-9)
      • conflict (15)
      • conflict (19)
      • conflict (30-31)
      • conflict (33-34)
      • conflict (36)
      • conflict (42)
      • conflict (49)
      • conflict (51)
      • conflict (53-54)
      • conflict (56)
      • conflict (71)
      • conflict (80-81)
      • conflict (94)
      • conflict (98-99)
      • conflict (103)
      • conflict (108)
      • conflict (115)
    Domains in SCOPe 2.07: d1afvk1, d1afvk2
  • Chain 'L':
    Compound: antibody fab25.3 fragment (light chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • GB AAA92993 (2-216)
      • conflict (3)
      • conflict (17-18)
      • conflict (29-30)
      • conflict (33)
      • conflict (35)
      • conflict (37)
      • conflict (39)
      • conflict (53)
      • conflict (57-58)
      • conflict (81)
      • conflict (84)
      • conflict (86)
      • conflict (88)
      • conflict (95-96)
      • conflict (99)
      • conflict (103)
      • conflict (107)
      • conflict (109)
    Domains in SCOPe 2.07: d1afvl1, d1afvl2
  • Chain 'M':
    Compound: antibody fab25.3 fragment (light chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • GB AAA92993 (2-216)
      • conflict (3)
      • conflict (17-18)
      • conflict (29-30)
      • conflict (33)
      • conflict (35)
      • conflict (37)
      • conflict (39)
      • conflict (53)
      • conflict (57-58)
      • conflict (81)
      • conflict (84)
      • conflict (86)
      • conflict (88)
      • conflict (95-96)
      • conflict (99)
      • conflict (103)
      • conflict (107)
      • conflict (109)
    Domains in SCOPe 2.07: d1afvm1, d1afvm2
  • Heterogens: PB

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1afvA (A:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsil
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1afvB (B:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsil
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1afvH (H:)
    qvqlqqpgsvlvrpgasvklsckasgytftsswihwakqrpgqglewigeihpnsgntny
    nekfkgkatltvdtssstayvdlssltsedsavyycarwrygspyyfdywgqgttltvss
    akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
    lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivpk
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1afvK (K:)
    qvqlqqpgsvlvrpgasvklsckasgytftsswihwakqrpgqglewigeihpnsgntny
    nekfkgkatltvdtssstayvdlssltsedsavyycarwrygspyyfdywgqgttltvss
    akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
    lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivpk
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1afvL (L:)
    divltqspaslavslgqratiscrasesvdnygisfmnwfqqkpgqppklliyaasnlgs
    gvparfsgsgsgtdfslnihpmeeedtamyfcqqskevpltfgagtkvelkradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnrne
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1afvM (M:)
    divltqspaslavslgqratiscrasesvdnygisfmnwfqqkpgqppklliyaasnlgs
    gvparfsgsgsgtdfslnihpmeeedtamyfcqqskevpltfgagtkvelkradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnrne